Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5W5G7

Protein Details
Accession K5W5G7   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
296-322ASGTGPRKGAKKPSKPQTPARSRAPPTHydrophilic
NLS Segment(s)
PositionSequence
273-283KRGGRAPVRRK
300-318GPRKGAKKPSKPQTPARSR
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046520  DUF6697  
KEGG pco:PHACADRAFT_257876  -  
Pfam View protein in Pfam  
PF20411  DUF6697  
Amino Acid Sequences MRQDIRKDKVELELVLPAGIRRRLKGLKSHEVKLDSEIRDVVVPRKFMSETCGGNVQALFPAIAQSKRAALGGHKHHLVYPTLKRNPEAPQMPGQPGLLCRALTTVPWEDAGIPKLKLVVGIGESMWGYMGDYTTEAAEPLSAMEWDGLPEQTKRTWATDIAAADKYIPLRSRIILHERLGREPTDGEVNDEAAVIKAGLGSRKERPKPTKDEIQQIIRAYSSGKQLIYIWRFKCVGYDEAFQRDLVSKFSAWRRRLTSSDQPAGGPQPPSVKRGGRAPVRRKDSNEGIQGSSATASGTGPRKGAKKPSKPQTPARSRAPPTGAAASIPSPPITPSPTSEAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.24
4 0.19
5 0.2
6 0.25
7 0.25
8 0.23
9 0.32
10 0.38
11 0.43
12 0.51
13 0.55
14 0.59
15 0.63
16 0.66
17 0.65
18 0.61
19 0.57
20 0.53
21 0.52
22 0.42
23 0.39
24 0.34
25 0.28
26 0.27
27 0.28
28 0.29
29 0.25
30 0.25
31 0.24
32 0.27
33 0.27
34 0.24
35 0.28
36 0.28
37 0.25
38 0.27
39 0.3
40 0.26
41 0.27
42 0.27
43 0.22
44 0.16
45 0.15
46 0.12
47 0.08
48 0.11
49 0.12
50 0.13
51 0.14
52 0.14
53 0.15
54 0.16
55 0.16
56 0.14
57 0.15
58 0.23
59 0.3
60 0.34
61 0.34
62 0.33
63 0.34
64 0.36
65 0.35
66 0.34
67 0.35
68 0.4
69 0.45
70 0.46
71 0.45
72 0.46
73 0.49
74 0.51
75 0.45
76 0.39
77 0.4
78 0.42
79 0.43
80 0.4
81 0.35
82 0.27
83 0.24
84 0.24
85 0.18
86 0.15
87 0.13
88 0.13
89 0.13
90 0.12
91 0.15
92 0.14
93 0.13
94 0.13
95 0.13
96 0.12
97 0.14
98 0.16
99 0.15
100 0.13
101 0.12
102 0.13
103 0.12
104 0.12
105 0.1
106 0.09
107 0.07
108 0.08
109 0.07
110 0.07
111 0.07
112 0.07
113 0.06
114 0.05
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.05
121 0.05
122 0.05
123 0.05
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.03
130 0.04
131 0.04
132 0.04
133 0.05
134 0.05
135 0.06
136 0.06
137 0.07
138 0.09
139 0.09
140 0.12
141 0.13
142 0.14
143 0.15
144 0.14
145 0.15
146 0.16
147 0.16
148 0.16
149 0.15
150 0.13
151 0.12
152 0.12
153 0.12
154 0.11
155 0.11
156 0.1
157 0.11
158 0.12
159 0.14
160 0.17
161 0.22
162 0.24
163 0.25
164 0.29
165 0.29
166 0.31
167 0.29
168 0.26
169 0.21
170 0.18
171 0.17
172 0.15
173 0.14
174 0.14
175 0.13
176 0.13
177 0.12
178 0.12
179 0.11
180 0.06
181 0.06
182 0.04
183 0.04
184 0.04
185 0.05
186 0.07
187 0.08
188 0.11
189 0.18
190 0.27
191 0.33
192 0.41
193 0.48
194 0.54
195 0.61
196 0.65
197 0.68
198 0.64
199 0.67
200 0.64
201 0.61
202 0.57
203 0.49
204 0.43
205 0.33
206 0.29
207 0.21
208 0.19
209 0.18
210 0.16
211 0.15
212 0.15
213 0.17
214 0.24
215 0.28
216 0.32
217 0.29
218 0.31
219 0.32
220 0.31
221 0.32
222 0.28
223 0.27
224 0.23
225 0.27
226 0.26
227 0.29
228 0.3
229 0.26
230 0.24
231 0.24
232 0.21
233 0.19
234 0.18
235 0.15
236 0.2
237 0.29
238 0.37
239 0.35
240 0.41
241 0.44
242 0.47
243 0.5
244 0.53
245 0.55
246 0.54
247 0.57
248 0.51
249 0.47
250 0.44
251 0.43
252 0.38
253 0.29
254 0.22
255 0.26
256 0.27
257 0.29
258 0.33
259 0.33
260 0.32
261 0.39
262 0.45
263 0.46
264 0.55
265 0.62
266 0.66
267 0.71
268 0.74
269 0.72
270 0.72
271 0.71
272 0.69
273 0.66
274 0.59
275 0.52
276 0.48
277 0.42
278 0.35
279 0.26
280 0.18
281 0.11
282 0.08
283 0.07
284 0.12
285 0.16
286 0.17
287 0.19
288 0.24
289 0.28
290 0.34
291 0.45
292 0.5
293 0.56
294 0.65
295 0.74
296 0.81
297 0.83
298 0.87
299 0.88
300 0.87
301 0.84
302 0.83
303 0.82
304 0.76
305 0.77
306 0.71
307 0.63
308 0.58
309 0.54
310 0.45
311 0.36
312 0.34
313 0.27
314 0.25
315 0.23
316 0.18
317 0.14
318 0.16
319 0.18
320 0.21
321 0.22
322 0.23