Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5W0A4

Protein Details
Accession K5W0A4   
Localization Confidence Low
Confidence Score 5.6
NoLS Segment(s)
PositionSequenceProtein Nature
104-131FGERPYHKLRVCKRCKKVMYCSIKCQTRHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 21, nucl 2, mito 2, cyto 2, cyto_nucl 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
KEGG pco:PHACADRAFT_254940  -  
Amino Acid Sequences MVNFFSLGAETLSGMDPVNASGSSEHADFRTAVRQVWHKTHEDLQALSPSTAPFRSVVLEWWVECGEKCGVNIEASYEPTMGPSSGTRRWRKDNGCAWRECLCFGERPYHKLRVCKRCKKVMYCSIKCQTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.07
5 0.09
6 0.07
7 0.08
8 0.07
9 0.09
10 0.11
11 0.11
12 0.11
13 0.1
14 0.12
15 0.11
16 0.13
17 0.18
18 0.17
19 0.17
20 0.2
21 0.26
22 0.3
23 0.35
24 0.38
25 0.34
26 0.36
27 0.4
28 0.42
29 0.37
30 0.33
31 0.28
32 0.28
33 0.26
34 0.23
35 0.19
36 0.14
37 0.13
38 0.13
39 0.12
40 0.09
41 0.08
42 0.09
43 0.09
44 0.1
45 0.11
46 0.11
47 0.1
48 0.11
49 0.11
50 0.1
51 0.09
52 0.1
53 0.09
54 0.08
55 0.08
56 0.09
57 0.09
58 0.1
59 0.1
60 0.1
61 0.1
62 0.11
63 0.11
64 0.1
65 0.09
66 0.09
67 0.1
68 0.07
69 0.07
70 0.08
71 0.12
72 0.19
73 0.28
74 0.34
75 0.39
76 0.47
77 0.55
78 0.58
79 0.63
80 0.66
81 0.67
82 0.67
83 0.63
84 0.6
85 0.57
86 0.53
87 0.45
88 0.38
89 0.29
90 0.27
91 0.27
92 0.33
93 0.29
94 0.34
95 0.39
96 0.46
97 0.47
98 0.53
99 0.61
100 0.62
101 0.71
102 0.76
103 0.79
104 0.8
105 0.86
106 0.85
107 0.86
108 0.85
109 0.85
110 0.81
111 0.83