Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VG15

Protein Details
Accession K5VG15   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
18-44NSPSSSRAPSPKQRTHKSKKQTHDSLPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 14.5, cyto 9
Family & Domain DBs
KEGG pco:PHACADRAFT_264689  -  
Amino Acid Sequences MFAQYSPLFTSGLRLADNSPSSSRAPSPKQRTHKSKKQTHDSLPITIWSATFSLCDGVPADSEDDALFLTFKPSRREIEEGRSFLSLDLADSHRSMSLRRKDTVTTTQGRSVPTSPVIAIPSLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.22
4 0.24
5 0.23
6 0.22
7 0.23
8 0.24
9 0.25
10 0.28
11 0.3
12 0.36
13 0.43
14 0.51
15 0.58
16 0.67
17 0.75
18 0.81
19 0.84
20 0.85
21 0.86
22 0.85
23 0.85
24 0.86
25 0.83
26 0.79
27 0.79
28 0.72
29 0.63
30 0.55
31 0.46
32 0.37
33 0.29
34 0.23
35 0.13
36 0.11
37 0.08
38 0.08
39 0.07
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.07
48 0.06
49 0.06
50 0.06
51 0.05
52 0.05
53 0.05
54 0.04
55 0.03
56 0.06
57 0.09
58 0.12
59 0.15
60 0.18
61 0.2
62 0.24
63 0.3
64 0.3
65 0.37
66 0.41
67 0.39
68 0.38
69 0.36
70 0.32
71 0.27
72 0.25
73 0.15
74 0.09
75 0.11
76 0.11
77 0.11
78 0.11
79 0.12
80 0.13
81 0.13
82 0.16
83 0.22
84 0.3
85 0.34
86 0.37
87 0.39
88 0.4
89 0.45
90 0.51
91 0.49
92 0.46
93 0.45
94 0.48
95 0.48
96 0.47
97 0.45
98 0.38
99 0.35
100 0.3
101 0.28
102 0.23
103 0.23
104 0.22