Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4R8T9

Protein Details
Accession C4R8T9    Localization Confidence High Confidence Score 21.1
NoLS Segment(s)
PositionSequenceProtein Nature
34-63QNAEIRQKYKEYNRYKRQQQANVTPRKEKKHydrophilic
111-133TGEVFRTPSKRKRPNSNESPLKLHydrophilic
271-303QEEPLHRKKATQKRTTRRAKIKVRKYHEKDEELBasic
NLS Segment(s)
PositionSequence
277-295RKKATQKRTTRRAKIKVRK
373-382KLKRKGKRRR
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021110  DNA_rep_checkpnt_protein  
IPR040203  Sld2  
Gene Ontology GO:0005634  C:nucleus  
GO:0007049  P:cell cycle  
GO:0006270  P:DNA replication initiation  
KEGG ppa:PAS_chr4_0752  -  
Pfam View protein in Pfam  
PF11719  Drc1-Sld2  
Amino Acid Sequences MMDQLQALRVEIKDWEYQFFKTKGWKPLAEDIKQNAEIRQKYKEYNRYKRQQQANVTPRKEKKVSGGAQTTPQKQSLEKEVATPRDLGPTPQVSGRVLSIFDISPVKRSATGEVFRTPSKRKRPNSNESPLKLTTPRKTPIARGPVLSETPLYLRQQSFSIQEELMAASPKVVQSESPLKVNLSSQETPTKITETFIEPSPVFDPVKLVKRKSLYEMSKDLEALQNEKLSIDGVDEDCLDEEVLKLMQGETGPDEEEFENGIDKETQLQPQEEPLHRKKATQKRTTRRAKIKVRKYHEKDEELDIEDITKKTDESIRQDLVKQTGAQELETESETNDDDDDDKGNKNTIFNPPPGGYRKTRTNLVSTNFVKYKLKRKGKRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.28
4 0.31
5 0.37
6 0.36
7 0.36
8 0.4
9 0.46
10 0.51
11 0.55
12 0.57
13 0.55
14 0.63
15 0.68
16 0.62
17 0.61
18 0.56
19 0.56
20 0.56
21 0.52
22 0.46
23 0.46
24 0.49
25 0.46
26 0.49
27 0.46
28 0.5
29 0.59
30 0.65
31 0.67
32 0.72
33 0.79
34 0.81
35 0.86
36 0.88
37 0.88
38 0.86
39 0.85
40 0.85
41 0.85
42 0.85
43 0.8
44 0.8
45 0.77
46 0.76
47 0.7
48 0.61
49 0.59
50 0.59
51 0.59
52 0.58
53 0.58
54 0.51
55 0.57
56 0.61
57 0.58
58 0.5
59 0.48
60 0.41
61 0.37
62 0.39
63 0.38
64 0.37
65 0.33
66 0.36
67 0.4
68 0.41
69 0.41
70 0.39
71 0.31
72 0.32
73 0.32
74 0.27
75 0.26
76 0.25
77 0.24
78 0.24
79 0.25
80 0.2
81 0.2
82 0.2
83 0.15
84 0.13
85 0.12
86 0.12
87 0.11
88 0.12
89 0.15
90 0.14
91 0.16
92 0.17
93 0.17
94 0.18
95 0.19
96 0.22
97 0.24
98 0.27
99 0.27
100 0.29
101 0.31
102 0.31
103 0.35
104 0.38
105 0.4
106 0.49
107 0.56
108 0.6
109 0.69
110 0.76
111 0.82
112 0.84
113 0.86
114 0.84
115 0.76
116 0.74
117 0.63
118 0.57
119 0.52
120 0.49
121 0.44
122 0.41
123 0.42
124 0.42
125 0.43
126 0.46
127 0.48
128 0.5
129 0.45
130 0.4
131 0.4
132 0.36
133 0.35
134 0.3
135 0.22
136 0.14
137 0.14
138 0.16
139 0.14
140 0.15
141 0.14
142 0.15
143 0.16
144 0.17
145 0.18
146 0.17
147 0.19
148 0.15
149 0.15
150 0.14
151 0.13
152 0.12
153 0.1
154 0.08
155 0.06
156 0.07
157 0.06
158 0.07
159 0.06
160 0.06
161 0.1
162 0.17
163 0.18
164 0.19
165 0.19
166 0.19
167 0.19
168 0.2
169 0.19
170 0.17
171 0.17
172 0.18
173 0.21
174 0.22
175 0.23
176 0.23
177 0.22
178 0.16
179 0.15
180 0.15
181 0.14
182 0.15
183 0.14
184 0.16
185 0.14
186 0.15
187 0.15
188 0.16
189 0.13
190 0.11
191 0.13
192 0.14
193 0.23
194 0.26
195 0.26
196 0.28
197 0.31
198 0.33
199 0.36
200 0.41
201 0.36
202 0.37
203 0.4
204 0.37
205 0.35
206 0.33
207 0.29
208 0.23
209 0.2
210 0.17
211 0.14
212 0.13
213 0.13
214 0.12
215 0.12
216 0.09
217 0.08
218 0.06
219 0.07
220 0.06
221 0.07
222 0.07
223 0.07
224 0.07
225 0.07
226 0.06
227 0.05
228 0.05
229 0.05
230 0.05
231 0.05
232 0.05
233 0.05
234 0.06
235 0.06
236 0.06
237 0.07
238 0.07
239 0.08
240 0.08
241 0.1
242 0.09
243 0.09
244 0.09
245 0.08
246 0.09
247 0.09
248 0.1
249 0.08
250 0.08
251 0.12
252 0.13
253 0.16
254 0.17
255 0.18
256 0.18
257 0.23
258 0.3
259 0.31
260 0.37
261 0.39
262 0.47
263 0.46
264 0.51
265 0.55
266 0.59
267 0.65
268 0.67
269 0.72
270 0.74
271 0.84
272 0.89
273 0.9
274 0.9
275 0.89
276 0.9
277 0.9
278 0.9
279 0.9
280 0.88
281 0.89
282 0.86
283 0.87
284 0.84
285 0.79
286 0.71
287 0.67
288 0.61
289 0.53
290 0.46
291 0.35
292 0.28
293 0.26
294 0.23
295 0.18
296 0.15
297 0.12
298 0.14
299 0.2
300 0.24
301 0.28
302 0.35
303 0.38
304 0.39
305 0.43
306 0.44
307 0.42
308 0.39
309 0.32
310 0.27
311 0.28
312 0.26
313 0.23
314 0.2
315 0.18
316 0.17
317 0.17
318 0.16
319 0.11
320 0.12
321 0.12
322 0.11
323 0.11
324 0.1
325 0.09
326 0.1
327 0.13
328 0.14
329 0.16
330 0.17
331 0.22
332 0.22
333 0.24
334 0.27
335 0.34
336 0.37
337 0.37
338 0.41
339 0.38
340 0.44
341 0.47
342 0.48
343 0.45
344 0.46
345 0.54
346 0.53
347 0.59
348 0.56
349 0.58
350 0.6
351 0.58
352 0.61
353 0.54
354 0.57
355 0.51
356 0.52
357 0.52
358 0.51
359 0.57
360 0.58
361 0.67
362 0.68