Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5W1B5

Protein Details
Accession K5W1B5    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
29-61DSCVDGQRKERKKGIKRGPYKRKAKPANGEGIPBasic
NLS Segment(s)
PositionSequence
36-55RKERKKGIKRGPYKRKAKPA
177-193SKGKKKARAKTGESPAK
Subcellular Location(s) mito 16, nucl 8.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG pco:PHACADRAFT_251386  -  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MACTNCAAACKRCDDSRPCERCQKYGLADSCVDGQRKERKKGIKRGPYKRKAKPANGEGIPASPSAAGEGEASAVSAPYAAPPPPEAYYPYYYPHAAFAPPPHDGPSHGEGSTNGNTHPMHQTYFPLHPAVYPQYTPYAHAPPVPYAAPPAVISPPPADANTKSPRAGHESGAESVSKGKKKARAKTGESPAKGKTATNEANGTNGTNGTNGVEAHGNATNGFQTTAGQPSYDLPGAGSGNDGHMVPSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.53
3 0.59
4 0.61
5 0.61
6 0.67
7 0.65
8 0.62
9 0.6
10 0.59
11 0.53
12 0.56
13 0.54
14 0.48
15 0.45
16 0.42
17 0.42
18 0.39
19 0.35
20 0.27
21 0.31
22 0.37
23 0.45
24 0.51
25 0.53
26 0.59
27 0.68
28 0.78
29 0.81
30 0.82
31 0.84
32 0.88
33 0.91
34 0.91
35 0.91
36 0.9
37 0.9
38 0.89
39 0.87
40 0.86
41 0.82
42 0.81
43 0.71
44 0.64
45 0.54
46 0.45
47 0.37
48 0.27
49 0.2
50 0.11
51 0.09
52 0.08
53 0.07
54 0.07
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.05
61 0.04
62 0.04
63 0.04
64 0.03
65 0.04
66 0.06
67 0.06
68 0.07
69 0.08
70 0.11
71 0.12
72 0.13
73 0.15
74 0.18
75 0.21
76 0.22
77 0.23
78 0.23
79 0.22
80 0.21
81 0.2
82 0.17
83 0.14
84 0.14
85 0.14
86 0.15
87 0.15
88 0.16
89 0.16
90 0.15
91 0.16
92 0.19
93 0.2
94 0.19
95 0.18
96 0.17
97 0.16
98 0.2
99 0.21
100 0.17
101 0.14
102 0.14
103 0.14
104 0.16
105 0.18
106 0.15
107 0.14
108 0.14
109 0.16
110 0.16
111 0.17
112 0.16
113 0.14
114 0.13
115 0.12
116 0.13
117 0.14
118 0.13
119 0.12
120 0.11
121 0.14
122 0.15
123 0.17
124 0.17
125 0.17
126 0.17
127 0.19
128 0.19
129 0.16
130 0.18
131 0.16
132 0.13
133 0.12
134 0.12
135 0.1
136 0.09
137 0.1
138 0.09
139 0.09
140 0.1
141 0.1
142 0.11
143 0.11
144 0.12
145 0.13
146 0.13
147 0.2
148 0.24
149 0.26
150 0.25
151 0.25
152 0.27
153 0.32
154 0.33
155 0.27
156 0.26
157 0.27
158 0.27
159 0.27
160 0.24
161 0.17
162 0.21
163 0.25
164 0.24
165 0.24
166 0.28
167 0.36
168 0.45
169 0.54
170 0.59
171 0.62
172 0.67
173 0.74
174 0.79
175 0.79
176 0.73
177 0.67
178 0.59
179 0.53
180 0.46
181 0.37
182 0.29
183 0.29
184 0.3
185 0.3
186 0.32
187 0.28
188 0.3
189 0.29
190 0.27
191 0.19
192 0.16
193 0.13
194 0.1
195 0.1
196 0.09
197 0.1
198 0.09
199 0.1
200 0.1
201 0.1
202 0.13
203 0.14
204 0.14
205 0.13
206 0.13
207 0.13
208 0.12
209 0.13
210 0.1
211 0.09
212 0.11
213 0.15
214 0.15
215 0.14
216 0.14
217 0.15
218 0.2
219 0.2
220 0.17
221 0.13
222 0.16
223 0.17
224 0.16
225 0.16
226 0.11
227 0.12
228 0.13
229 0.12