Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5WQK5

Protein Details
Accession K5WQK5    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
89-118KASMTTMRKRDKKREQQRKEESARRKRRLABasic
122-152AIEGPKRGSGRRKRQRKMKTAQKLEETRKHVBasic
NLS Segment(s)
PositionSequence
96-165RKRDKKREQQRKEESARRKRRLAEDIAIEGPKRGSGRRKRQRKMKTAQKLEETRKHVKEREEARNKAKAS
Subcellular Location(s) nucl 21, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG pco:PHACADRAFT_204913  -  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MQPVDNDTFFKRLAALFETSKDSGSIWLTHKRLIRDEDNAQIPLTDSTDDINEYPCLVRVTDGKETNFSTRVNPGKLDAFHAQYGTLLKASMTTMRKRDKKREQQRKEESARRKRRLAEDIAIEGPKRGSGRRKRQRKMKTAQKLEETRKHVKEREEARNKAKAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.2
4 0.22
5 0.27
6 0.26
7 0.25
8 0.22
9 0.19
10 0.18
11 0.18
12 0.2
13 0.19
14 0.27
15 0.28
16 0.32
17 0.35
18 0.36
19 0.39
20 0.41
21 0.42
22 0.39
23 0.41
24 0.43
25 0.42
26 0.4
27 0.34
28 0.28
29 0.25
30 0.19
31 0.17
32 0.11
33 0.08
34 0.08
35 0.09
36 0.1
37 0.09
38 0.1
39 0.09
40 0.09
41 0.09
42 0.1
43 0.1
44 0.09
45 0.1
46 0.11
47 0.16
48 0.22
49 0.24
50 0.23
51 0.25
52 0.27
53 0.28
54 0.27
55 0.23
56 0.18
57 0.22
58 0.25
59 0.24
60 0.22
61 0.22
62 0.22
63 0.22
64 0.25
65 0.21
66 0.19
67 0.18
68 0.18
69 0.16
70 0.13
71 0.14
72 0.1
73 0.08
74 0.06
75 0.05
76 0.05
77 0.06
78 0.11
79 0.14
80 0.17
81 0.24
82 0.33
83 0.41
84 0.47
85 0.58
86 0.63
87 0.71
88 0.79
89 0.84
90 0.84
91 0.87
92 0.9
93 0.89
94 0.87
95 0.85
96 0.84
97 0.84
98 0.86
99 0.81
100 0.77
101 0.73
102 0.72
103 0.7
104 0.66
105 0.6
106 0.53
107 0.49
108 0.46
109 0.41
110 0.33
111 0.27
112 0.21
113 0.18
114 0.16
115 0.17
116 0.25
117 0.35
118 0.46
119 0.57
120 0.68
121 0.75
122 0.84
123 0.9
124 0.9
125 0.91
126 0.9
127 0.91
128 0.9
129 0.88
130 0.87
131 0.86
132 0.84
133 0.82
134 0.79
135 0.77
136 0.75
137 0.75
138 0.71
139 0.68
140 0.68
141 0.69
142 0.73
143 0.73
144 0.73
145 0.73