Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VDX8

Protein Details
Accession K5VDX8   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
161-184DPSLAVRPRRLRRRSPPAHHDFRCBasic
NLS Segment(s)
PositionSequence
170-173RLRR
Subcellular Location(s) mito 16, cyto 4, extr 4, nucl 2
Family & Domain DBs
KEGG pco:PHACADRAFT_107038  -  
Amino Acid Sequences RKLKCGLARPALVCKHWSEAIRPILFQELELRDAEDVRFLKNIVSSPGFAASCLYGSIKRIYIRQEATGAKPWLHHVHGLSARLQNTTFDCVVENHAGDAASAAGRWAPFESIPTVTLSYVRLSVLVLQGVVFTSKTELVRLVHNCPTLSYCSCEQLTFLDPSLAVRPRRLRRRSPPAHHDFRCTVDGCKDMVGPSQAALAADIVDPARRIGLDNSTWDTPLQGLLALAPHGPGKATGNLYCRNPGKCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.39
3 0.38
4 0.37
5 0.32
6 0.36
7 0.43
8 0.41
9 0.39
10 0.35
11 0.36
12 0.34
13 0.3
14 0.29
15 0.22
16 0.23
17 0.23
18 0.22
19 0.18
20 0.19
21 0.18
22 0.17
23 0.16
24 0.15
25 0.16
26 0.15
27 0.16
28 0.17
29 0.19
30 0.17
31 0.19
32 0.18
33 0.18
34 0.22
35 0.2
36 0.18
37 0.18
38 0.13
39 0.11
40 0.11
41 0.12
42 0.09
43 0.11
44 0.14
45 0.16
46 0.18
47 0.2
48 0.24
49 0.3
50 0.31
51 0.3
52 0.33
53 0.32
54 0.34
55 0.39
56 0.36
57 0.3
58 0.28
59 0.31
60 0.29
61 0.28
62 0.27
63 0.2
64 0.25
65 0.28
66 0.28
67 0.27
68 0.27
69 0.26
70 0.25
71 0.24
72 0.19
73 0.18
74 0.2
75 0.17
76 0.13
77 0.13
78 0.13
79 0.16
80 0.15
81 0.14
82 0.1
83 0.1
84 0.1
85 0.09
86 0.08
87 0.05
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.05
94 0.05
95 0.05
96 0.05
97 0.07
98 0.08
99 0.08
100 0.09
101 0.1
102 0.1
103 0.09
104 0.1
105 0.1
106 0.08
107 0.08
108 0.07
109 0.07
110 0.06
111 0.07
112 0.07
113 0.06
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.04
120 0.03
121 0.04
122 0.06
123 0.07
124 0.07
125 0.09
126 0.09
127 0.15
128 0.17
129 0.2
130 0.22
131 0.23
132 0.23
133 0.22
134 0.22
135 0.21
136 0.19
137 0.19
138 0.16
139 0.18
140 0.19
141 0.18
142 0.17
143 0.15
144 0.17
145 0.15
146 0.14
147 0.11
148 0.1
149 0.12
150 0.16
151 0.19
152 0.17
153 0.22
154 0.31
155 0.4
156 0.5
157 0.56
158 0.62
159 0.67
160 0.78
161 0.83
162 0.83
163 0.84
164 0.83
165 0.86
166 0.78
167 0.74
168 0.65
169 0.58
170 0.53
171 0.44
172 0.37
173 0.3
174 0.29
175 0.24
176 0.22
177 0.19
178 0.16
179 0.17
180 0.16
181 0.13
182 0.12
183 0.12
184 0.11
185 0.11
186 0.1
187 0.08
188 0.07
189 0.06
190 0.07
191 0.06
192 0.07
193 0.07
194 0.07
195 0.08
196 0.07
197 0.09
198 0.11
199 0.16
200 0.18
201 0.21
202 0.26
203 0.26
204 0.27
205 0.25
206 0.23
207 0.18
208 0.16
209 0.13
210 0.08
211 0.07
212 0.07
213 0.08
214 0.08
215 0.08
216 0.08
217 0.08
218 0.08
219 0.09
220 0.1
221 0.12
222 0.17
223 0.21
224 0.25
225 0.3
226 0.35
227 0.38
228 0.45
229 0.47