Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5W6T2

Protein Details
Accession K5W6T2   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
85-112SSGTSLVGRRRRRSTQRARTARRCTSWNHydrophilic
NLS Segment(s)
PositionSequence
94-97RRRR
Subcellular Location(s) mito 16.5, cyto_mito 11, cyto 4.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004364  Aa-tRNA-synt_II  
IPR045864  aa-tRNA-synth_II/BPL/LPL  
IPR018149  Lys-tRNA-synth_II_C  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005524  F:ATP binding  
GO:0004824  F:lysine-tRNA ligase activity  
GO:0006430  P:lysyl-tRNA aminoacylation  
KEGG pco:PHACADRAFT_258968  -  
Pfam View protein in Pfam  
PF00152  tRNA-synt_2  
Amino Acid Sequences MVTGNATAKSFIVHHNGLYLRAAHELYLKQVVIGGPNRVYEIGRLLRNAGIDLTYNPGFATCECHAACADMYDIMDTTESLIEVSSGTSLVGRRRRRSTQRARTARRCTSWN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.23
3 0.24
4 0.24
5 0.24
6 0.21
7 0.16
8 0.17
9 0.17
10 0.12
11 0.15
12 0.14
13 0.15
14 0.17
15 0.16
16 0.13
17 0.15
18 0.15
19 0.15
20 0.17
21 0.17
22 0.15
23 0.15
24 0.16
25 0.15
26 0.15
27 0.12
28 0.15
29 0.16
30 0.16
31 0.16
32 0.17
33 0.17
34 0.17
35 0.17
36 0.12
37 0.08
38 0.07
39 0.07
40 0.1
41 0.09
42 0.09
43 0.09
44 0.09
45 0.09
46 0.08
47 0.14
48 0.1
49 0.14
50 0.14
51 0.15
52 0.15
53 0.16
54 0.16
55 0.11
56 0.1
57 0.06
58 0.07
59 0.06
60 0.06
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.04
69 0.04
70 0.04
71 0.05
72 0.04
73 0.04
74 0.04
75 0.06
76 0.08
77 0.15
78 0.24
79 0.32
80 0.4
81 0.48
82 0.58
83 0.67
84 0.76
85 0.8
86 0.83
87 0.86
88 0.89
89 0.92
90 0.92
91 0.92
92 0.9