Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VEL6

Protein Details
Accession K5VEL6    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
557-582LVDELRQKQSRIRRERRRQAQINNEEHydrophilic
NLS Segment(s)
Subcellular Location(s) pero 8, mito 7, cyto_nucl 6, nucl 5.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015324  Ribosomal_Rsm22-like  
IPR016522  Ribosome_S22_mit_bud  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
GO:0006412  P:translation  
KEGG pco:PHACADRAFT_248077  -  
Pfam View protein in Pfam  
PF09243  Rsm22  
Amino Acid Sequences MSLLRHKTVHSSDLAKTPRELEVYPNDPADVDDYMTSEELDFQEADADDKSTRKSPAALFGSQRIGAVVLPLELQKAITQLISESDKPMLHVDAKRLFLDENESGAEWDTTYDVRYKSREQRVRHAERDGTAFASVALPAHYSAIYAVLHHLKQRLSPGWSVQHVIDWGAGTGSGLWASSYAFQKPPEEGAEEVDVQFVKSTLASYIGIEKREGLVKIGKRLLKGTDVGDVSVSWQKAFHEDNKLPRVDGGGVLSLSAFMLSSLPNTVARKKAVKEMWESGADIIVLIDHNTTTGFQCIADARDNLLRMGKREMEDPDAKDWPVRGSHVVAPCPHDGACPLFNVGPKSLVCGFSQRLQRPEFVRKTKHSKMGHEDIGYSYVVIRRGARPEQPNSKFGRIGDIGRRELEKIAAAQASAAELVVDRDASQPAKPTKPPVDPSLTIDPAGVDMTPQDIQETLRSEAYYWPRLVFPPLKRSGHIVLDGCTSEGKIMRMTVPKSQGKQPFYDARKSSWGDIFPHDPKNPPQVRFTPEMAGRRPAPGNQPKNTATSKHSYAQLVDELRQKQSRIRRERRRQAQINNEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.42
3 0.4
4 0.38
5 0.37
6 0.36
7 0.33
8 0.31
9 0.35
10 0.37
11 0.38
12 0.36
13 0.32
14 0.28
15 0.28
16 0.24
17 0.17
18 0.14
19 0.11
20 0.12
21 0.13
22 0.13
23 0.13
24 0.1
25 0.12
26 0.11
27 0.13
28 0.12
29 0.1
30 0.13
31 0.13
32 0.15
33 0.13
34 0.14
35 0.13
36 0.16
37 0.19
38 0.2
39 0.23
40 0.23
41 0.28
42 0.29
43 0.37
44 0.4
45 0.41
46 0.4
47 0.42
48 0.44
49 0.4
50 0.37
51 0.27
52 0.22
53 0.17
54 0.15
55 0.11
56 0.08
57 0.08
58 0.08
59 0.09
60 0.08
61 0.09
62 0.08
63 0.09
64 0.09
65 0.09
66 0.09
67 0.08
68 0.12
69 0.16
70 0.16
71 0.17
72 0.19
73 0.19
74 0.2
75 0.22
76 0.2
77 0.23
78 0.25
79 0.3
80 0.33
81 0.35
82 0.34
83 0.33
84 0.31
85 0.25
86 0.29
87 0.23
88 0.19
89 0.17
90 0.17
91 0.16
92 0.17
93 0.16
94 0.1
95 0.09
96 0.09
97 0.08
98 0.09
99 0.13
100 0.14
101 0.17
102 0.21
103 0.29
104 0.38
105 0.48
106 0.55
107 0.56
108 0.65
109 0.73
110 0.78
111 0.74
112 0.71
113 0.63
114 0.58
115 0.57
116 0.47
117 0.37
118 0.28
119 0.23
120 0.18
121 0.14
122 0.12
123 0.08
124 0.07
125 0.06
126 0.06
127 0.07
128 0.07
129 0.06
130 0.06
131 0.08
132 0.08
133 0.07
134 0.1
135 0.13
136 0.14
137 0.17
138 0.2
139 0.19
140 0.21
141 0.26
142 0.28
143 0.27
144 0.28
145 0.3
146 0.32
147 0.33
148 0.33
149 0.27
150 0.24
151 0.21
152 0.2
153 0.16
154 0.11
155 0.09
156 0.07
157 0.07
158 0.05
159 0.05
160 0.04
161 0.04
162 0.03
163 0.03
164 0.03
165 0.04
166 0.08
167 0.09
168 0.12
169 0.14
170 0.15
171 0.17
172 0.18
173 0.2
174 0.18
175 0.18
176 0.17
177 0.17
178 0.18
179 0.17
180 0.16
181 0.14
182 0.12
183 0.1
184 0.1
185 0.08
186 0.06
187 0.05
188 0.06
189 0.05
190 0.07
191 0.07
192 0.07
193 0.15
194 0.17
195 0.17
196 0.17
197 0.17
198 0.17
199 0.19
200 0.19
201 0.14
202 0.18
203 0.2
204 0.25
205 0.3
206 0.31
207 0.29
208 0.31
209 0.3
210 0.26
211 0.26
212 0.21
213 0.21
214 0.19
215 0.18
216 0.16
217 0.14
218 0.14
219 0.15
220 0.15
221 0.1
222 0.1
223 0.1
224 0.14
225 0.16
226 0.18
227 0.23
228 0.26
229 0.34
230 0.38
231 0.38
232 0.35
233 0.32
234 0.3
235 0.22
236 0.19
237 0.13
238 0.09
239 0.08
240 0.08
241 0.08
242 0.06
243 0.05
244 0.04
245 0.03
246 0.02
247 0.03
248 0.03
249 0.04
250 0.04
251 0.05
252 0.08
253 0.1
254 0.12
255 0.15
256 0.17
257 0.21
258 0.22
259 0.29
260 0.29
261 0.31
262 0.33
263 0.33
264 0.33
265 0.3
266 0.29
267 0.21
268 0.19
269 0.15
270 0.1
271 0.07
272 0.04
273 0.03
274 0.03
275 0.03
276 0.03
277 0.03
278 0.03
279 0.04
280 0.04
281 0.05
282 0.05
283 0.05
284 0.06
285 0.07
286 0.08
287 0.1
288 0.09
289 0.1
290 0.12
291 0.13
292 0.12
293 0.15
294 0.14
295 0.14
296 0.17
297 0.18
298 0.16
299 0.19
300 0.2
301 0.22
302 0.25
303 0.25
304 0.25
305 0.24
306 0.24
307 0.22
308 0.2
309 0.16
310 0.14
311 0.14
312 0.12
313 0.13
314 0.18
315 0.2
316 0.21
317 0.21
318 0.23
319 0.22
320 0.22
321 0.19
322 0.15
323 0.13
324 0.14
325 0.14
326 0.1
327 0.11
328 0.11
329 0.13
330 0.15
331 0.14
332 0.14
333 0.13
334 0.16
335 0.17
336 0.17
337 0.16
338 0.18
339 0.19
340 0.22
341 0.3
342 0.3
343 0.33
344 0.33
345 0.37
346 0.38
347 0.46
348 0.49
349 0.48
350 0.52
351 0.55
352 0.62
353 0.65
354 0.69
355 0.64
356 0.62
357 0.63
358 0.63
359 0.6
360 0.51
361 0.45
362 0.37
363 0.34
364 0.27
365 0.19
366 0.13
367 0.11
368 0.12
369 0.12
370 0.13
371 0.14
372 0.2
373 0.23
374 0.29
375 0.33
376 0.4
377 0.49
378 0.51
379 0.54
380 0.54
381 0.54
382 0.49
383 0.43
384 0.42
385 0.34
386 0.35
387 0.36
388 0.36
389 0.34
390 0.34
391 0.34
392 0.29
393 0.28
394 0.24
395 0.18
396 0.13
397 0.14
398 0.13
399 0.12
400 0.11
401 0.1
402 0.09
403 0.08
404 0.07
405 0.04
406 0.04
407 0.04
408 0.05
409 0.05
410 0.05
411 0.06
412 0.09
413 0.1
414 0.11
415 0.17
416 0.22
417 0.27
418 0.29
419 0.35
420 0.4
421 0.47
422 0.5
423 0.48
424 0.51
425 0.47
426 0.51
427 0.5
428 0.44
429 0.37
430 0.33
431 0.27
432 0.21
433 0.2
434 0.13
435 0.06
436 0.05
437 0.07
438 0.08
439 0.08
440 0.08
441 0.08
442 0.09
443 0.13
444 0.16
445 0.16
446 0.17
447 0.17
448 0.17
449 0.24
450 0.29
451 0.3
452 0.28
453 0.27
454 0.27
455 0.28
456 0.34
457 0.35
458 0.35
459 0.4
460 0.47
461 0.48
462 0.47
463 0.51
464 0.5
465 0.46
466 0.45
467 0.36
468 0.3
469 0.3
470 0.29
471 0.25
472 0.2
473 0.16
474 0.13
475 0.14
476 0.13
477 0.12
478 0.13
479 0.18
480 0.24
481 0.27
482 0.31
483 0.38
484 0.44
485 0.46
486 0.53
487 0.57
488 0.54
489 0.55
490 0.55
491 0.57
492 0.55
493 0.61
494 0.54
495 0.5
496 0.55
497 0.54
498 0.51
499 0.46
500 0.45
501 0.39
502 0.41
503 0.45
504 0.42
505 0.47
506 0.45
507 0.44
508 0.46
509 0.54
510 0.56
511 0.51
512 0.54
513 0.53
514 0.56
515 0.57
516 0.54
517 0.51
518 0.5
519 0.54
520 0.5
521 0.5
522 0.45
523 0.45
524 0.45
525 0.42
526 0.46
527 0.5
528 0.55
529 0.54
530 0.6
531 0.57
532 0.61
533 0.61
534 0.54
535 0.5
536 0.48
537 0.48
538 0.46
539 0.49
540 0.45
541 0.42
542 0.42
543 0.42
544 0.38
545 0.36
546 0.39
547 0.37
548 0.41
549 0.44
550 0.42
551 0.43
552 0.5
553 0.57
554 0.61
555 0.69
556 0.73
557 0.81
558 0.91
559 0.94
560 0.95
561 0.94
562 0.93