Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5XDL3

Protein Details
Accession K5XDL3    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
58-79EIRGSGRKIRPQKRTGKARLGDBasic
NLS Segment(s)
PositionSequence
59-95IRGSGRKIRPQKRTGKARLGDKKSPMLRGGGVAFGPK
Subcellular Location(s) cysk 11, nucl 5, mito 5, mito_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002136  Ribosomal_L4/L1e  
IPR023574  Ribosomal_L4_dom_sf  
IPR013005  Ribosomal_uL4/L1e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pco:PHACADRAFT_247505  -  
Pfam View protein in Pfam  
PF00573  Ribosomal_L4  
Amino Acid Sequences MSSLLRPQQDQPPVEEMLVQLDPLVFSHPIRRDILHLCVVHHLDSLRQGTASTKTRSEIRGSGRKIRPQKRTGKARLGDKKSPMLRGGGVAFGPKPRDFSTKLPRKVTQMGMRIALSARVKERAFGVVESLEWDMPKTKSFAARLEELSWGKTLFVTGLNEVPTNLERASGNIPLVDTVTAEELTVYDAVKWPRLVLDLAAVDWFEQTLGRHQTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.33
3 0.25
4 0.21
5 0.2
6 0.15
7 0.11
8 0.1
9 0.1
10 0.1
11 0.12
12 0.09
13 0.1
14 0.18
15 0.22
16 0.25
17 0.27
18 0.28
19 0.3
20 0.32
21 0.36
22 0.35
23 0.32
24 0.29
25 0.32
26 0.32
27 0.28
28 0.26
29 0.21
30 0.16
31 0.2
32 0.21
33 0.16
34 0.15
35 0.14
36 0.15
37 0.22
38 0.27
39 0.25
40 0.24
41 0.26
42 0.3
43 0.32
44 0.34
45 0.33
46 0.35
47 0.41
48 0.44
49 0.52
50 0.54
51 0.61
52 0.67
53 0.7
54 0.71
55 0.71
56 0.77
57 0.77
58 0.82
59 0.81
60 0.8
61 0.77
62 0.78
63 0.79
64 0.75
65 0.71
66 0.64
67 0.64
68 0.57
69 0.54
70 0.45
71 0.36
72 0.29
73 0.25
74 0.22
75 0.15
76 0.13
77 0.11
78 0.1
79 0.1
80 0.13
81 0.11
82 0.14
83 0.15
84 0.19
85 0.22
86 0.29
87 0.38
88 0.45
89 0.51
90 0.53
91 0.52
92 0.53
93 0.53
94 0.51
95 0.47
96 0.42
97 0.38
98 0.34
99 0.32
100 0.29
101 0.24
102 0.22
103 0.16
104 0.13
105 0.13
106 0.16
107 0.16
108 0.16
109 0.17
110 0.15
111 0.16
112 0.14
113 0.14
114 0.1
115 0.1
116 0.11
117 0.11
118 0.08
119 0.07
120 0.08
121 0.09
122 0.1
123 0.11
124 0.11
125 0.12
126 0.17
127 0.19
128 0.23
129 0.24
130 0.26
131 0.27
132 0.27
133 0.29
134 0.25
135 0.24
136 0.2
137 0.17
138 0.14
139 0.12
140 0.11
141 0.07
142 0.09
143 0.09
144 0.1
145 0.12
146 0.13
147 0.13
148 0.13
149 0.14
150 0.13
151 0.13
152 0.12
153 0.12
154 0.1
155 0.13
156 0.16
157 0.16
158 0.15
159 0.13
160 0.14
161 0.13
162 0.13
163 0.11
164 0.08
165 0.07
166 0.08
167 0.08
168 0.08
169 0.07
170 0.07
171 0.08
172 0.08
173 0.08
174 0.07
175 0.11
176 0.13
177 0.17
178 0.17
179 0.16
180 0.17
181 0.19
182 0.19
183 0.15
184 0.18
185 0.15
186 0.16
187 0.16
188 0.14
189 0.12
190 0.11
191 0.11
192 0.06
193 0.07
194 0.08
195 0.15