Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WD71

Protein Details
Accession K5WD71    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-35RLTKRTCTYRIRRPTRTSRLLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, E.R. 3, cyto 2, plas 2, extr 1, cyto_nucl 1, pero 1, vacu 1
Family & Domain DBs
KEGG pco:PHACADRAFT_254876  -  
Amino Acid Sequences MKAQISFKAMSWKGRLTKRTCTYRIRRPTRTSRLLALPRARASDPGRRGNSDCCTFVVGVAFWHLSVSVWLVTAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.57
3 0.52
4 0.6
5 0.64
6 0.69
7 0.68
8 0.7
9 0.72
10 0.74
11 0.79
12 0.78
13 0.78
14 0.77
15 0.81
16 0.8
17 0.78
18 0.7
19 0.63
20 0.62
21 0.58
22 0.56
23 0.49
24 0.43
25 0.37
26 0.37
27 0.33
28 0.3
29 0.3
30 0.32
31 0.35
32 0.4
33 0.41
34 0.42
35 0.43
36 0.44
37 0.46
38 0.41
39 0.36
40 0.29
41 0.28
42 0.26
43 0.24
44 0.2
45 0.14
46 0.11
47 0.11
48 0.11
49 0.08
50 0.09
51 0.08
52 0.07
53 0.08
54 0.09
55 0.07