Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VBI5

Protein Details
Accession K5VBI5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
7-27RLSKASRKPLTPKRGNKDYYKHydrophilic
NLS Segment(s)
PositionSequence
19-19K
Subcellular Location(s) mito 19, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019189  Ribosomal_L27/L41_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG pco:PHACADRAFT_132385  -  
Pfam View protein in Pfam  
PF09809  MRP-L27  
Amino Acid Sequences MFATLVRLSKASRKPLTPKRGNKDYYKGTRQAVLPGGPRTGAPGKHVVKGKAKYRLLDEKVRYFVAPPIEDILASPLKPYVHTDVKLTKAQEREVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.65
3 0.74
4 0.76
5 0.79
6 0.78
7 0.83
8 0.81
9 0.78
10 0.76
11 0.75
12 0.73
13 0.7
14 0.65
15 0.57
16 0.56
17 0.5
18 0.45
19 0.38
20 0.32
21 0.29
22 0.26
23 0.25
24 0.2
25 0.19
26 0.2
27 0.2
28 0.18
29 0.16
30 0.23
31 0.24
32 0.29
33 0.32
34 0.31
35 0.35
36 0.4
37 0.44
38 0.44
39 0.45
40 0.41
41 0.44
42 0.5
43 0.47
44 0.5
45 0.48
46 0.43
47 0.44
48 0.43
49 0.38
50 0.3
51 0.28
52 0.25
53 0.22
54 0.18
55 0.18
56 0.17
57 0.17
58 0.16
59 0.17
60 0.13
61 0.13
62 0.12
63 0.12
64 0.12
65 0.14
66 0.17
67 0.21
68 0.26
69 0.27
70 0.32
71 0.36
72 0.4
73 0.44
74 0.43
75 0.42
76 0.39