Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WG55

Protein Details
Accession K5WG55    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
145-167KVRIATGKKKTAKRTRNEAEYKAHydrophilic
NLS Segment(s)
PositionSequence
51-53KGK
152-157KKKTAK
Subcellular Location(s) nucl 13.5, cyto_nucl 12, cyto 9.5, mito 3
Family & Domain DBs
KEGG pco:PHACADRAFT_206919  -  
Amino Acid Sequences MPPKRKSNVLEPSVDLTADESQQEAATQARPAMKKARTSDVAESSSTGAKKGKGKAKVEDNAPNNWWEVKLPGEDERGVLVFDDCNEIRCKIRLLQKEPGFKVTHWLQAIGNINNNSYQRFMKATGPTGGASNGTYYSAYVYFEKVRIATGKKKTAKRTRNEAEYKAGMPLEDRKTVWIMGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.31
3 0.23
4 0.2
5 0.17
6 0.14
7 0.11
8 0.1
9 0.1
10 0.11
11 0.09
12 0.09
13 0.1
14 0.1
15 0.13
16 0.18
17 0.19
18 0.23
19 0.3
20 0.33
21 0.39
22 0.42
23 0.47
24 0.46
25 0.5
26 0.52
27 0.49
28 0.47
29 0.39
30 0.36
31 0.3
32 0.29
33 0.24
34 0.2
35 0.16
36 0.19
37 0.24
38 0.31
39 0.36
40 0.41
41 0.45
42 0.51
43 0.57
44 0.58
45 0.58
46 0.58
47 0.54
48 0.49
49 0.46
50 0.39
51 0.32
52 0.27
53 0.22
54 0.14
55 0.13
56 0.11
57 0.11
58 0.12
59 0.13
60 0.14
61 0.14
62 0.14
63 0.13
64 0.12
65 0.11
66 0.09
67 0.07
68 0.05
69 0.05
70 0.08
71 0.08
72 0.09
73 0.1
74 0.11
75 0.12
76 0.13
77 0.14
78 0.16
79 0.24
80 0.29
81 0.34
82 0.42
83 0.46
84 0.53
85 0.52
86 0.52
87 0.45
88 0.38
89 0.38
90 0.32
91 0.31
92 0.24
93 0.24
94 0.2
95 0.23
96 0.27
97 0.23
98 0.24
99 0.2
100 0.2
101 0.21
102 0.22
103 0.18
104 0.16
105 0.16
106 0.13
107 0.15
108 0.17
109 0.2
110 0.22
111 0.25
112 0.24
113 0.25
114 0.24
115 0.23
116 0.21
117 0.16
118 0.13
119 0.11
120 0.09
121 0.08
122 0.08
123 0.07
124 0.09
125 0.09
126 0.1
127 0.1
128 0.12
129 0.13
130 0.14
131 0.15
132 0.14
133 0.16
134 0.19
135 0.24
136 0.3
137 0.37
138 0.46
139 0.53
140 0.61
141 0.69
142 0.75
143 0.79
144 0.79
145 0.82
146 0.81
147 0.83
148 0.83
149 0.76
150 0.73
151 0.67
152 0.59
153 0.51
154 0.42
155 0.31
156 0.27
157 0.31
158 0.28
159 0.29
160 0.28
161 0.28
162 0.3