Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VQH6

Protein Details
Accession K5VQH6    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-27RLSKASRKPLTPKRGNKDYYKHydrophilic
NLS Segment(s)
PositionSequence
19-19K
Subcellular Location(s) mito 22, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019189  Ribosomal_L27/L41_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG pco:PHACADRAFT_266092  -  
Pfam View protein in Pfam  
PF09809  MRP-L27  
Amino Acid Sequences MFATLVRLSKASRKPLTPKRGNKDYYKGTRQAVLPGGPRTGAPGKHVVKGKAKYRLLDEKVRYFVAPPIEDILASPLKPYVHTDVKLTKAQEREVLGKLPRGGLNGAHLLSLAAKQGEVAHSSEAANTSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.66
3 0.75
4 0.77
5 0.8
6 0.79
7 0.84
8 0.82
9 0.79
10 0.78
11 0.77
12 0.75
13 0.72
14 0.68
15 0.6
16 0.59
17 0.53
18 0.48
19 0.41
20 0.35
21 0.32
22 0.29
23 0.28
24 0.23
25 0.22
26 0.22
27 0.23
28 0.2
29 0.19
30 0.26
31 0.27
32 0.32
33 0.36
34 0.35
35 0.39
36 0.45
37 0.49
38 0.49
39 0.49
40 0.46
41 0.48
42 0.53
43 0.49
44 0.51
45 0.48
46 0.42
47 0.42
48 0.41
49 0.35
50 0.27
51 0.25
52 0.21
53 0.17
54 0.14
55 0.13
56 0.13
57 0.13
58 0.12
59 0.12
60 0.09
61 0.09
62 0.09
63 0.09
64 0.09
65 0.1
66 0.12
67 0.15
68 0.19
69 0.2
70 0.24
71 0.26
72 0.3
73 0.33
74 0.32
75 0.31
76 0.29
77 0.29
78 0.3
79 0.29
80 0.29
81 0.27
82 0.3
83 0.27
84 0.28
85 0.27
86 0.26
87 0.25
88 0.23
89 0.21
90 0.18
91 0.2
92 0.19
93 0.18
94 0.15
95 0.14
96 0.12
97 0.12
98 0.12
99 0.1
100 0.07
101 0.07
102 0.08
103 0.09
104 0.11
105 0.12
106 0.13
107 0.13
108 0.14
109 0.14
110 0.15