Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5W6Z1

Protein Details
Accession K5W6Z1    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
337-359AATPSLRHGRRRKRDLVHTLVRLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 7, cyto 6.5, mito 6, cyto_nucl 6, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001251  CRAL-TRIO_dom  
IPR036865  CRAL-TRIO_dom_sf  
Gene Ontology GO:0016020  C:membrane  
KEGG pco:PHACADRAFT_124083  -  
Pfam View protein in Pfam  
PF00650  CRAL_TRIO  
PROSITE View protein in PROSITE  
PS50191  CRAL_TRIO  
CDD cd00170  SEC14  
Amino Acid Sequences MVFDILEALQHQSELLDSLYDQNLKAARQLQSTLEHKILPGLVDEEGLDEADVEYAVQWLYDIPSIFRILKRQKFTASLALEALRTTLLWRLRTLPPLACKPPLPCFTCLPSHAHDPFGHPIVVIQTAKVLSGAEDLKALSAHTSELMRLHLVELNKARHSSVRGARPILQYVALLDIGGMSLSGWQFIDLMNWHVVELLPRYPGMLAAVFILNYSWTHSGFWSIAKRILPKHSLQKIFFVTAPQLRQLLSPANLPKDYGGDLPLIAEMPSPLEQYVASPPAASDSPGAHCAEYPLTGSMVDPEATSPEATAPIRTVLSSTSLLNPFFGYPAVYDAAATPSLRHGRRRKRDLVHTLVRLWWARWGARAVLMLVLLLLLLVARRWRIQLRVIFDRRRPTVLPVRAFLPWFRNVFWRTYPRAALYLTRAHAEVIVPRHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.07
4 0.08
5 0.11
6 0.15
7 0.16
8 0.16
9 0.19
10 0.21
11 0.21
12 0.25
13 0.28
14 0.28
15 0.3
16 0.33
17 0.32
18 0.38
19 0.4
20 0.41
21 0.36
22 0.33
23 0.29
24 0.3
25 0.27
26 0.2
27 0.18
28 0.15
29 0.13
30 0.13
31 0.12
32 0.11
33 0.1
34 0.1
35 0.08
36 0.06
37 0.06
38 0.06
39 0.06
40 0.05
41 0.04
42 0.05
43 0.05
44 0.04
45 0.04
46 0.05
47 0.06
48 0.09
49 0.09
50 0.1
51 0.12
52 0.15
53 0.18
54 0.19
55 0.27
56 0.35
57 0.43
58 0.48
59 0.5
60 0.51
61 0.53
62 0.55
63 0.54
64 0.46
65 0.4
66 0.35
67 0.32
68 0.28
69 0.23
70 0.2
71 0.11
72 0.09
73 0.08
74 0.12
75 0.16
76 0.17
77 0.18
78 0.23
79 0.27
80 0.32
81 0.34
82 0.34
83 0.36
84 0.42
85 0.44
86 0.42
87 0.42
88 0.41
89 0.46
90 0.48
91 0.45
92 0.41
93 0.41
94 0.42
95 0.43
96 0.41
97 0.37
98 0.33
99 0.37
100 0.35
101 0.35
102 0.31
103 0.31
104 0.33
105 0.31
106 0.27
107 0.19
108 0.19
109 0.17
110 0.2
111 0.16
112 0.12
113 0.12
114 0.12
115 0.12
116 0.12
117 0.1
118 0.06
119 0.09
120 0.1
121 0.08
122 0.09
123 0.09
124 0.09
125 0.09
126 0.08
127 0.06
128 0.06
129 0.06
130 0.07
131 0.07
132 0.07
133 0.08
134 0.09
135 0.09
136 0.09
137 0.09
138 0.11
139 0.11
140 0.15
141 0.19
142 0.21
143 0.23
144 0.23
145 0.23
146 0.22
147 0.25
148 0.29
149 0.31
150 0.35
151 0.37
152 0.38
153 0.43
154 0.42
155 0.41
156 0.34
157 0.27
158 0.2
159 0.17
160 0.15
161 0.1
162 0.08
163 0.06
164 0.05
165 0.04
166 0.04
167 0.03
168 0.02
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.05
175 0.05
176 0.06
177 0.05
178 0.07
179 0.08
180 0.08
181 0.08
182 0.08
183 0.08
184 0.08
185 0.09
186 0.08
187 0.08
188 0.07
189 0.08
190 0.07
191 0.08
192 0.07
193 0.06
194 0.05
195 0.05
196 0.06
197 0.05
198 0.05
199 0.05
200 0.04
201 0.04
202 0.06
203 0.06
204 0.06
205 0.07
206 0.07
207 0.09
208 0.09
209 0.12
210 0.12
211 0.13
212 0.15
213 0.17
214 0.19
215 0.21
216 0.25
217 0.26
218 0.27
219 0.35
220 0.4
221 0.44
222 0.42
223 0.43
224 0.4
225 0.39
226 0.35
227 0.27
228 0.22
229 0.2
230 0.2
231 0.17
232 0.16
233 0.14
234 0.14
235 0.15
236 0.15
237 0.13
238 0.16
239 0.17
240 0.2
241 0.19
242 0.19
243 0.18
244 0.16
245 0.17
246 0.13
247 0.11
248 0.09
249 0.09
250 0.09
251 0.08
252 0.07
253 0.06
254 0.05
255 0.04
256 0.06
257 0.06
258 0.07
259 0.07
260 0.07
261 0.07
262 0.08
263 0.11
264 0.11
265 0.1
266 0.09
267 0.09
268 0.11
269 0.12
270 0.11
271 0.1
272 0.09
273 0.11
274 0.14
275 0.15
276 0.12
277 0.12
278 0.13
279 0.12
280 0.11
281 0.1
282 0.09
283 0.09
284 0.08
285 0.08
286 0.08
287 0.09
288 0.08
289 0.07
290 0.07
291 0.08
292 0.09
293 0.09
294 0.08
295 0.07
296 0.1
297 0.1
298 0.11
299 0.1
300 0.11
301 0.11
302 0.11
303 0.11
304 0.09
305 0.12
306 0.12
307 0.13
308 0.16
309 0.18
310 0.18
311 0.18
312 0.18
313 0.15
314 0.15
315 0.14
316 0.09
317 0.07
318 0.09
319 0.1
320 0.09
321 0.09
322 0.09
323 0.11
324 0.12
325 0.11
326 0.09
327 0.15
328 0.23
329 0.25
330 0.34
331 0.43
332 0.53
333 0.64
334 0.72
335 0.76
336 0.78
337 0.85
338 0.85
339 0.84
340 0.82
341 0.75
342 0.68
343 0.6
344 0.55
345 0.46
346 0.37
347 0.33
348 0.28
349 0.25
350 0.26
351 0.27
352 0.24
353 0.25
354 0.25
355 0.21
356 0.18
357 0.17
358 0.13
359 0.1
360 0.08
361 0.05
362 0.04
363 0.03
364 0.02
365 0.02
366 0.04
367 0.06
368 0.08
369 0.1
370 0.14
371 0.18
372 0.22
373 0.3
374 0.35
375 0.41
376 0.5
377 0.58
378 0.62
379 0.64
380 0.69
381 0.65
382 0.64
383 0.58
384 0.56
385 0.57
386 0.58
387 0.57
388 0.5
389 0.49
390 0.47
391 0.47
392 0.42
393 0.37
394 0.34
395 0.32
396 0.32
397 0.37
398 0.37
399 0.4
400 0.45
401 0.47
402 0.48
403 0.52
404 0.54
405 0.49
406 0.5
407 0.47
408 0.44
409 0.41
410 0.41
411 0.37
412 0.35
413 0.32
414 0.29
415 0.28
416 0.25
417 0.25