Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5W9Y9

Protein Details
Accession K5W9Y9   
Localization Confidence Medium
Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
62-88VDTPEPIIQRDKKKNSKHKATEPSTSGHydrophilic
NLS Segment(s)
PositionSequence
74-79KKNSKH
253-261GKGKKKPKS
Subcellular Location(s) nucl 18, cyto_nucl 14.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036882  Alba-like_dom_sf  
IPR014612  Pop7/Rpp20  
Gene Ontology GO:0005655  C:nucleolar ribonuclease P complex  
GO:0000172  C:ribonuclease MRP complex  
GO:0003676  F:nucleic acid binding  
GO:0004526  F:ribonuclease P activity  
GO:0001682  P:tRNA 5'-leader removal  
KEGG pco:PHACADRAFT_257045  -  
Pfam View protein in Pfam  
PF12328  Rpp20  
Amino Acid Sequences MPTSGKRSAADTPTDESAGKKAKPSVQPSGGGPSSSRGPTPAARSSTKTTDAMKDSEHAMGVDTPEPIIQRDKKKNSKHKATEPSTSGGAAKVTHRKLAPPRPFPTVPTSVSATGPRSAHVEGKNHICVTRKTPLGAYLRRCKDVVLKAGCVPVASSQYAMGLTSGFRHKTLHLHAMGAAIPHLVQLSLSLPEILPYSPEEIETEVMTGTVEVQDEVIPEDSDEDISIRSRGKSTLSIIMKITDGKDEGAHTGKGKKKPKSGTSDVRMGDVGKRQQRRGGQSGENGGENEGEAGEGDVPERVVFRAEDVEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.34
3 0.28
4 0.3
5 0.32
6 0.3
7 0.31
8 0.34
9 0.41
10 0.49
11 0.54
12 0.57
13 0.55
14 0.57
15 0.54
16 0.56
17 0.49
18 0.41
19 0.35
20 0.28
21 0.28
22 0.27
23 0.25
24 0.18
25 0.21
26 0.25
27 0.31
28 0.35
29 0.35
30 0.37
31 0.42
32 0.46
33 0.48
34 0.47
35 0.44
36 0.4
37 0.41
38 0.41
39 0.38
40 0.34
41 0.3
42 0.28
43 0.26
44 0.22
45 0.16
46 0.14
47 0.13
48 0.14
49 0.13
50 0.11
51 0.1
52 0.11
53 0.12
54 0.12
55 0.18
56 0.24
57 0.32
58 0.43
59 0.53
60 0.61
61 0.72
62 0.81
63 0.84
64 0.88
65 0.87
66 0.87
67 0.88
68 0.83
69 0.8
70 0.72
71 0.64
72 0.54
73 0.45
74 0.36
75 0.25
76 0.21
77 0.15
78 0.16
79 0.21
80 0.22
81 0.25
82 0.25
83 0.31
84 0.39
85 0.48
86 0.53
87 0.54
88 0.56
89 0.59
90 0.59
91 0.56
92 0.53
93 0.48
94 0.4
95 0.34
96 0.34
97 0.27
98 0.28
99 0.27
100 0.23
101 0.21
102 0.2
103 0.18
104 0.18
105 0.18
106 0.22
107 0.23
108 0.24
109 0.23
110 0.28
111 0.29
112 0.27
113 0.28
114 0.25
115 0.24
116 0.26
117 0.29
118 0.26
119 0.24
120 0.24
121 0.29
122 0.33
123 0.36
124 0.38
125 0.41
126 0.43
127 0.43
128 0.43
129 0.37
130 0.37
131 0.36
132 0.38
133 0.31
134 0.3
135 0.29
136 0.3
137 0.29
138 0.22
139 0.18
140 0.11
141 0.1
142 0.09
143 0.08
144 0.07
145 0.08
146 0.08
147 0.07
148 0.06
149 0.04
150 0.04
151 0.06
152 0.09
153 0.09
154 0.09
155 0.1
156 0.11
157 0.16
158 0.19
159 0.23
160 0.21
161 0.21
162 0.21
163 0.21
164 0.2
165 0.16
166 0.12
167 0.06
168 0.05
169 0.05
170 0.04
171 0.03
172 0.03
173 0.03
174 0.04
175 0.05
176 0.05
177 0.06
178 0.06
179 0.06
180 0.07
181 0.07
182 0.07
183 0.07
184 0.09
185 0.09
186 0.09
187 0.09
188 0.1
189 0.11
190 0.1
191 0.09
192 0.07
193 0.07
194 0.06
195 0.05
196 0.05
197 0.04
198 0.04
199 0.04
200 0.05
201 0.05
202 0.05
203 0.07
204 0.07
205 0.07
206 0.07
207 0.08
208 0.08
209 0.07
210 0.07
211 0.07
212 0.06
213 0.07
214 0.09
215 0.1
216 0.11
217 0.12
218 0.13
219 0.16
220 0.18
221 0.21
222 0.28
223 0.28
224 0.29
225 0.29
226 0.29
227 0.27
228 0.25
229 0.22
230 0.16
231 0.14
232 0.13
233 0.13
234 0.13
235 0.15
236 0.17
237 0.17
238 0.18
239 0.25
240 0.31
241 0.39
242 0.47
243 0.53
244 0.59
245 0.67
246 0.73
247 0.75
248 0.77
249 0.78
250 0.76
251 0.76
252 0.67
253 0.59
254 0.51
255 0.43
256 0.38
257 0.35
258 0.37
259 0.37
260 0.43
261 0.44
262 0.51
263 0.57
264 0.61
265 0.62
266 0.6
267 0.58
268 0.57
269 0.61
270 0.56
271 0.5
272 0.42
273 0.35
274 0.28
275 0.22
276 0.17
277 0.1
278 0.07
279 0.06
280 0.06
281 0.06
282 0.06
283 0.07
284 0.07
285 0.07
286 0.08
287 0.09
288 0.08
289 0.1
290 0.1
291 0.12
292 0.16