Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5V0C3

Protein Details
Accession K5V0C3    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-36SPDHLRLTPAQKKARRQHLKTTKNRPTDIKEHydrophilic
NLS Segment(s)
PositionSequence
18-22KARRQ
Subcellular Location(s) mito 10, nucl 4, cyto 4, plas 4, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004574  Alkb  
IPR027450  AlkB-like  
IPR037151  AlkB-like_sf  
IPR005123  Oxoglu/Fe-dep_dioxygenase  
Gene Ontology GO:0051213  F:dioxygenase activity  
GO:0006281  P:DNA repair  
KEGG pco:PHACADRAFT_174062  -  
Pfam View protein in Pfam  
PF13532  2OG-FeII_Oxy_2  
PROSITE View protein in PROSITE  
PS51471  FE2OG_OXY  
Amino Acid Sequences MTAVASPDHLRLTPAQKKARRQHLKTTKNRPTDIKEGWTPFRAAEKRFKAKWPPPDMSSVLDLHLEDTDCASGSGGEASQTGRRGAVDWRQIDVPVNEKGNKAYVFPRISGMRDHFVSRMYILIAYIICKYMICRLSGLVYLPGFVSSDEQRRLIHWSLKDHAKLPNETNLDAHYLFPPGGLWDVYLKFLNDGTDEETIQPKASTSSSPAASSTPYNASADPTSGPRTLISNSPASPSLLPTLLTLSTPPPAPSPNAKPCSPAALVPKLRWANIGWHYHWGNKQYDFTRGRGGGVAEVYRAVCKRAVQSVNWEDVYRGIAITADEGDGGAIEEWRTWREDYEPDAGIVNFYQTSDTLMAHVDRSELCAASPLVSISLGCTAVFLIGGPTRDTEPVPIFLRSGDVLIMSGPCRRAYHGVPRILEDTCPAHLLGSFNSQTAPSSDQGDDWKPYAEYMRSARINVNVRQVFPRGFDPGLPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.53
3 0.59
4 0.69
5 0.77
6 0.82
7 0.83
8 0.81
9 0.84
10 0.85
11 0.88
12 0.88
13 0.9
14 0.88
15 0.86
16 0.85
17 0.82
18 0.78
19 0.77
20 0.71
21 0.67
22 0.65
23 0.62
24 0.61
25 0.56
26 0.5
27 0.42
28 0.47
29 0.45
30 0.42
31 0.47
32 0.52
33 0.58
34 0.61
35 0.67
36 0.68
37 0.71
38 0.77
39 0.75
40 0.71
41 0.64
42 0.67
43 0.61
44 0.53
45 0.48
46 0.38
47 0.3
48 0.25
49 0.23
50 0.17
51 0.16
52 0.14
53 0.11
54 0.11
55 0.1
56 0.09
57 0.1
58 0.09
59 0.07
60 0.07
61 0.08
62 0.06
63 0.06
64 0.07
65 0.09
66 0.12
67 0.13
68 0.13
69 0.13
70 0.13
71 0.15
72 0.19
73 0.26
74 0.31
75 0.31
76 0.33
77 0.33
78 0.33
79 0.35
80 0.31
81 0.27
82 0.24
83 0.27
84 0.26
85 0.26
86 0.27
87 0.28
88 0.27
89 0.26
90 0.25
91 0.29
92 0.29
93 0.29
94 0.32
95 0.29
96 0.3
97 0.33
98 0.33
99 0.29
100 0.28
101 0.29
102 0.25
103 0.24
104 0.24
105 0.19
106 0.16
107 0.13
108 0.11
109 0.09
110 0.1
111 0.09
112 0.09
113 0.09
114 0.09
115 0.08
116 0.08
117 0.09
118 0.14
119 0.16
120 0.16
121 0.16
122 0.16
123 0.17
124 0.18
125 0.19
126 0.15
127 0.13
128 0.12
129 0.12
130 0.11
131 0.1
132 0.09
133 0.11
134 0.11
135 0.17
136 0.18
137 0.19
138 0.19
139 0.2
140 0.26
141 0.27
142 0.3
143 0.27
144 0.31
145 0.35
146 0.4
147 0.41
148 0.38
149 0.39
150 0.38
151 0.38
152 0.36
153 0.38
154 0.34
155 0.33
156 0.31
157 0.26
158 0.25
159 0.21
160 0.2
161 0.13
162 0.12
163 0.11
164 0.1
165 0.09
166 0.07
167 0.07
168 0.06
169 0.06
170 0.08
171 0.08
172 0.1
173 0.11
174 0.1
175 0.1
176 0.1
177 0.1
178 0.08
179 0.09
180 0.1
181 0.1
182 0.11
183 0.11
184 0.12
185 0.12
186 0.12
187 0.11
188 0.08
189 0.09
190 0.1
191 0.09
192 0.11
193 0.15
194 0.15
195 0.15
196 0.16
197 0.15
198 0.15
199 0.15
200 0.13
201 0.12
202 0.12
203 0.12
204 0.12
205 0.13
206 0.12
207 0.13
208 0.11
209 0.11
210 0.13
211 0.13
212 0.13
213 0.11
214 0.13
215 0.13
216 0.15
217 0.15
218 0.15
219 0.15
220 0.16
221 0.16
222 0.16
223 0.14
224 0.13
225 0.12
226 0.1
227 0.1
228 0.08
229 0.09
230 0.08
231 0.08
232 0.08
233 0.07
234 0.08
235 0.08
236 0.09
237 0.08
238 0.09
239 0.12
240 0.16
241 0.23
242 0.31
243 0.34
244 0.34
245 0.35
246 0.35
247 0.37
248 0.33
249 0.29
250 0.25
251 0.29
252 0.3
253 0.28
254 0.35
255 0.31
256 0.31
257 0.29
258 0.25
259 0.23
260 0.28
261 0.32
262 0.26
263 0.3
264 0.31
265 0.33
266 0.35
267 0.33
268 0.3
269 0.27
270 0.31
271 0.27
272 0.35
273 0.34
274 0.32
275 0.33
276 0.31
277 0.29
278 0.26
279 0.25
280 0.17
281 0.16
282 0.15
283 0.09
284 0.1
285 0.09
286 0.1
287 0.1
288 0.1
289 0.1
290 0.11
291 0.14
292 0.21
293 0.23
294 0.22
295 0.31
296 0.33
297 0.36
298 0.35
299 0.33
300 0.25
301 0.23
302 0.23
303 0.15
304 0.11
305 0.07
306 0.06
307 0.06
308 0.07
309 0.06
310 0.05
311 0.05
312 0.05
313 0.04
314 0.04
315 0.04
316 0.04
317 0.04
318 0.04
319 0.05
320 0.06
321 0.07
322 0.1
323 0.1
324 0.11
325 0.13
326 0.16
327 0.19
328 0.23
329 0.22
330 0.21
331 0.21
332 0.2
333 0.18
334 0.15
335 0.12
336 0.08
337 0.07
338 0.08
339 0.06
340 0.09
341 0.09
342 0.09
343 0.09
344 0.1
345 0.11
346 0.11
347 0.11
348 0.1
349 0.09
350 0.12
351 0.12
352 0.11
353 0.1
354 0.13
355 0.13
356 0.13
357 0.13
358 0.1
359 0.09
360 0.09
361 0.09
362 0.07
363 0.09
364 0.08
365 0.07
366 0.07
367 0.07
368 0.07
369 0.07
370 0.06
371 0.06
372 0.08
373 0.09
374 0.1
375 0.11
376 0.13
377 0.14
378 0.15
379 0.17
380 0.17
381 0.21
382 0.23
383 0.22
384 0.21
385 0.2
386 0.22
387 0.18
388 0.16
389 0.11
390 0.09
391 0.08
392 0.09
393 0.1
394 0.09
395 0.12
396 0.13
397 0.15
398 0.16
399 0.19
400 0.24
401 0.28
402 0.38
403 0.43
404 0.49
405 0.47
406 0.5
407 0.49
408 0.44
409 0.39
410 0.31
411 0.26
412 0.2
413 0.2
414 0.17
415 0.15
416 0.16
417 0.17
418 0.16
419 0.2
420 0.2
421 0.19
422 0.2
423 0.19
424 0.19
425 0.2
426 0.21
427 0.15
428 0.19
429 0.19
430 0.2
431 0.26
432 0.29
433 0.29
434 0.27
435 0.28
436 0.24
437 0.25
438 0.28
439 0.25
440 0.27
441 0.29
442 0.37
443 0.36
444 0.38
445 0.4
446 0.43
447 0.48
448 0.46
449 0.52
450 0.46
451 0.47
452 0.49
453 0.5
454 0.44
455 0.4
456 0.39
457 0.34
458 0.32