Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WZQ5

Protein Details
Accession K5WZQ5    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-31AETPQKTSKRQKVASKHVEFHydrophilic
NLS Segment(s)
PositionSequence
8-10KKR
58-64KKRGGRK
Subcellular Location(s) mito 13, nucl 7, cyto 7, cyto_nucl 7
Family & Domain DBs
KEGG pco:PHACADRAFT_196048  -  
Amino Acid Sequences MPPRNHGKKRAAETPQKTSKRQKVASKHVEFDNEAVMTQFRLSGEFSSEDAVQGSPAKKRGGRKGPGVQDVAEGEVLMAFAVVKKRLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.77
3 0.74
4 0.74
5 0.75
6 0.75
7 0.75
8 0.75
9 0.75
10 0.74
11 0.79
12 0.83
13 0.77
14 0.71
15 0.63
16 0.58
17 0.5
18 0.4
19 0.32
20 0.21
21 0.17
22 0.13
23 0.11
24 0.08
25 0.07
26 0.07
27 0.05
28 0.06
29 0.06
30 0.06
31 0.08
32 0.09
33 0.09
34 0.1
35 0.1
36 0.09
37 0.09
38 0.09
39 0.08
40 0.09
41 0.1
42 0.11
43 0.15
44 0.18
45 0.21
46 0.28
47 0.38
48 0.45
49 0.49
50 0.56
51 0.61
52 0.65
53 0.67
54 0.62
55 0.52
56 0.44
57 0.39
58 0.32
59 0.23
60 0.15
61 0.1
62 0.08
63 0.07
64 0.05
65 0.04
66 0.03
67 0.05
68 0.09