Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VR17

Protein Details
Accession K5VR17    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
17-40AKALLRRQARDRRREEKHKALLTRBasic
NLS Segment(s)
PositionSequence
22-35RRQARDRRREEKHK
Subcellular Location(s) cyto 18, cyto_nucl 10.5, mito 8
Family & Domain DBs
KEGG pco:PHACADRAFT_202107  -  
Amino Acid Sequences MLVCSAETTHVPIKQDAKALLRRQARDRRREEKHKALLTRAESKVVLDGADVGQDETLLPVHHVNVDVFKLADEAANLTAGLGNLHVIVESAEVVVDEAPTPEFIPATPALSDTVILGGSPSPALTEATLVDIVADAPPLGAKEPRLIVEALVVRKMSIDEGFLDFGGFSVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.34
4 0.36
5 0.42
6 0.44
7 0.48
8 0.51
9 0.53
10 0.59
11 0.66
12 0.68
13 0.7
14 0.75
15 0.76
16 0.79
17 0.85
18 0.85
19 0.85
20 0.85
21 0.82
22 0.76
23 0.71
24 0.67
25 0.62
26 0.61
27 0.51
28 0.44
29 0.37
30 0.34
31 0.3
32 0.24
33 0.18
34 0.1
35 0.1
36 0.07
37 0.08
38 0.08
39 0.06
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.04
46 0.05
47 0.05
48 0.06
49 0.07
50 0.07
51 0.07
52 0.08
53 0.08
54 0.08
55 0.08
56 0.07
57 0.07
58 0.06
59 0.06
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.04
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.04
87 0.04
88 0.05
89 0.05
90 0.05
91 0.04
92 0.07
93 0.07
94 0.09
95 0.08
96 0.09
97 0.1
98 0.1
99 0.1
100 0.07
101 0.07
102 0.05
103 0.05
104 0.05
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04
110 0.05
111 0.06
112 0.05
113 0.06
114 0.06
115 0.08
116 0.08
117 0.07
118 0.07
119 0.06
120 0.06
121 0.06
122 0.05
123 0.04
124 0.04
125 0.04
126 0.05
127 0.06
128 0.08
129 0.09
130 0.12
131 0.14
132 0.16
133 0.18
134 0.17
135 0.16
136 0.2
137 0.24
138 0.22
139 0.22
140 0.21
141 0.18
142 0.19
143 0.19
144 0.16
145 0.12
146 0.12
147 0.12
148 0.14
149 0.15
150 0.15
151 0.14
152 0.12