Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5V2I1

Protein Details
Accession K5V2I1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
56-77LGYPSPRTPKRHTRNVGCRLHSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, mito 4, E.R. 3, cyto_mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG pco:PHACADRAFT_254032  -  
Amino Acid Sequences MSDLQSKDPTAEVDAGPLTVDTRGVPISTLARALFIAVGVIGLLHTAFVWVHFYQLGYPSPRTPKRHTRNVGCRLHSRYSERSMYEEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.13
4 0.11
5 0.09
6 0.07
7 0.07
8 0.05
9 0.07
10 0.07
11 0.07
12 0.07
13 0.08
14 0.1
15 0.1
16 0.11
17 0.09
18 0.09
19 0.09
20 0.09
21 0.07
22 0.06
23 0.05
24 0.03
25 0.03
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.03
36 0.06
37 0.06
38 0.07
39 0.07
40 0.08
41 0.08
42 0.1
43 0.13
44 0.13
45 0.15
46 0.18
47 0.27
48 0.35
49 0.41
50 0.46
51 0.55
52 0.61
53 0.7
54 0.75
55 0.77
56 0.8
57 0.84
58 0.85
59 0.79
60 0.78
61 0.74
62 0.71
63 0.66
64 0.62
65 0.59
66 0.57
67 0.58
68 0.52