Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WIJ5

Protein Details
Accession K5WIJ5    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
41-71KERDSAMEAPRRRRKRKRDSGNRQANKRAYIBasic
NLS Segment(s)
PositionSequence
49-67APRRRRKRKRDSGNRQANK
Subcellular Location(s) nucl 21, cyto_nucl 13, cyto 3
Family & Domain DBs
KEGG pco:PHACADRAFT_249043  -  
Amino Acid Sequences MYLAGIRQIHYADFERVSFNYMLYDALIKQKERDDASTNGKERDSAMEAPRRRRKRKRDSGNRQANKRAYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.19
4 0.22
5 0.19
6 0.16
7 0.13
8 0.12
9 0.12
10 0.1
11 0.1
12 0.07
13 0.13
14 0.15
15 0.14
16 0.16
17 0.18
18 0.22
19 0.22
20 0.25
21 0.23
22 0.25
23 0.32
24 0.36
25 0.35
26 0.33
27 0.31
28 0.28
29 0.25
30 0.25
31 0.21
32 0.19
33 0.23
34 0.3
35 0.34
36 0.44
37 0.54
38 0.61
39 0.67
40 0.74
41 0.81
42 0.84
43 0.91
44 0.92
45 0.93
46 0.94
47 0.95
48 0.96
49 0.94
50 0.9
51 0.89