Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VVG7

Protein Details
Accession K5VVG7    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-41MANPRQRRKLKSGSHKPVRHSSHAKKNLKKQPPIRGPKVLQHydrophilic
NLS Segment(s)
PositionSequence
5-38RQRRKLKSGSHKPVRHSSHAKKNLKKQPPIRGPK
Subcellular Location(s) mito 13, nucl 9.5, cyto_nucl 7.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019002  Ribosome_biogenesis_Nop16  
Gene Ontology GO:0005730  C:nucleolus  
KEGG pco:PHACADRAFT_94806  -  
Pfam View protein in Pfam  
PF09420  Nop16  
Amino Acid Sequences MANPRQRRKLKSGSHKPVRHSSHAKKNLKKQPPIRGPKVLQEAWDKHKTVRQNYEALGLVASLTPTASGGVEKPLGAASKNEPPVDVDCALEASSSKVAGPSSLPKGYGRIVRDADGNVVDVELPEEGEGGDERGGPAASAERLIEDIPDPSKQKGVADWVGVGSQASAERTHPFGILTVGRGRSRRTIGLEELGQTRGGPVVRHSSRGELGVLHRLVAQHGSDVEAMVRDRKLNVDQRSAGQLVRAIKKAGGVEELLKGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.86
3 0.84
4 0.84
5 0.8
6 0.78
7 0.78
8 0.76
9 0.77
10 0.82
11 0.85
12 0.84
13 0.87
14 0.88
15 0.87
16 0.87
17 0.85
18 0.85
19 0.86
20 0.88
21 0.84
22 0.83
23 0.76
24 0.74
25 0.74
26 0.64
27 0.57
28 0.55
29 0.54
30 0.52
31 0.56
32 0.49
33 0.43
34 0.47
35 0.5
36 0.5
37 0.54
38 0.5
39 0.48
40 0.48
41 0.49
42 0.45
43 0.37
44 0.29
45 0.19
46 0.15
47 0.1
48 0.09
49 0.05
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.05
56 0.05
57 0.08
58 0.08
59 0.08
60 0.09
61 0.09
62 0.1
63 0.1
64 0.11
65 0.12
66 0.19
67 0.22
68 0.22
69 0.21
70 0.23
71 0.24
72 0.26
73 0.23
74 0.16
75 0.13
76 0.13
77 0.13
78 0.11
79 0.09
80 0.07
81 0.07
82 0.07
83 0.06
84 0.07
85 0.07
86 0.07
87 0.09
88 0.11
89 0.15
90 0.16
91 0.17
92 0.16
93 0.18
94 0.21
95 0.24
96 0.21
97 0.22
98 0.22
99 0.22
100 0.23
101 0.21
102 0.19
103 0.15
104 0.14
105 0.09
106 0.08
107 0.07
108 0.05
109 0.05
110 0.04
111 0.04
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.06
133 0.05
134 0.06
135 0.07
136 0.1
137 0.11
138 0.11
139 0.13
140 0.13
141 0.13
142 0.13
143 0.17
144 0.16
145 0.15
146 0.15
147 0.14
148 0.13
149 0.13
150 0.11
151 0.06
152 0.05
153 0.05
154 0.05
155 0.06
156 0.07
157 0.09
158 0.11
159 0.11
160 0.11
161 0.11
162 0.1
163 0.12
164 0.12
165 0.12
166 0.14
167 0.17
168 0.19
169 0.21
170 0.23
171 0.26
172 0.28
173 0.3
174 0.31
175 0.32
176 0.32
177 0.34
178 0.33
179 0.3
180 0.28
181 0.25
182 0.21
183 0.16
184 0.14
185 0.12
186 0.12
187 0.1
188 0.11
189 0.21
190 0.22
191 0.26
192 0.27
193 0.29
194 0.29
195 0.3
196 0.28
197 0.2
198 0.21
199 0.25
200 0.24
201 0.2
202 0.2
203 0.19
204 0.19
205 0.19
206 0.17
207 0.11
208 0.11
209 0.12
210 0.11
211 0.11
212 0.11
213 0.11
214 0.12
215 0.13
216 0.15
217 0.14
218 0.15
219 0.19
220 0.26
221 0.33
222 0.38
223 0.43
224 0.44
225 0.45
226 0.5
227 0.47
228 0.4
229 0.32
230 0.31
231 0.3
232 0.34
233 0.33
234 0.29
235 0.28
236 0.32
237 0.32
238 0.3
239 0.25
240 0.21
241 0.21