Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WYI7

Protein Details
Accession K5WYI7   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGKRKKSSRKPTGPRRREPLESTBasic
NLS Segment(s)
PositionSequence
3-17KRKKSSRKPTGPRRR
Subcellular Location(s) mito 21, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
KEGG pco:PHACADRAFT_71199  -  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRKPTGPRRREPLESTFTCLFCHHDKSVSVRMDRKEGIAQLFCKVCDQRFQSKVNHLTEPIDIYSEWIDAADAAERQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.89
3 0.85
4 0.8
5 0.74
6 0.7
7 0.67
8 0.58
9 0.55
10 0.5
11 0.43
12 0.38
13 0.33
14 0.3
15 0.24
16 0.28
17 0.22
18 0.22
19 0.22
20 0.27
21 0.34
22 0.33
23 0.34
24 0.33
25 0.34
26 0.35
27 0.34
28 0.3
29 0.24
30 0.22
31 0.21
32 0.19
33 0.18
34 0.17
35 0.17
36 0.16
37 0.17
38 0.17
39 0.16
40 0.2
41 0.25
42 0.31
43 0.35
44 0.38
45 0.4
46 0.48
47 0.54
48 0.51
49 0.48
50 0.4
51 0.37
52 0.35
53 0.33
54 0.24
55 0.19
56 0.15
57 0.14
58 0.14
59 0.12
60 0.11
61 0.08
62 0.08
63 0.07
64 0.08
65 0.08