Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5W6W5

Protein Details
Accession K5W6W5    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MIGTLRAKDTRRRRPQRPSSILRISTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, E.R. 3, nucl 1, cyto 1, plas 1, extr 1, cyto_nucl 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG pco:PHACADRAFT_259048  -  
Amino Acid Sequences MIGTLRAKDTRRRRPQRPSSILRISTYNIALSTVISVLTAPIVTLSTHHCIAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.9
3 0.91
4 0.9
5 0.85
6 0.83
7 0.81
8 0.73
9 0.63
10 0.54
11 0.44
12 0.36
13 0.3
14 0.21
15 0.13
16 0.11
17 0.1
18 0.08
19 0.07
20 0.05
21 0.05
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.03
28 0.04
29 0.05
30 0.05
31 0.06
32 0.11
33 0.15