Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5W0H9

Protein Details
Accession K5W0H9    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-37ATKATRRKAADKEKAPRKTKKDKNAPKRALSAYHydrophilic
NLS Segment(s)
PositionSequence
7-32KATRRKAADKEKAPRKTKKDKNAPKR
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG pco:PHACADRAFT_164552  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEATKATRRKAADKEKAPRKTKKDKNAPKRALSAYMFFSQDWRERVKAENPDASFGELGKLLGTKWKELDEEEKKPYIEQAERDKARAEREKKDYDNKKVDSGSGDGDEDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.73
3 0.78
4 0.79
5 0.85
6 0.86
7 0.85
8 0.83
9 0.84
10 0.84
11 0.85
12 0.86
13 0.87
14 0.9
15 0.91
16 0.9
17 0.84
18 0.8
19 0.71
20 0.66
21 0.57
22 0.48
23 0.4
24 0.35
25 0.31
26 0.24
27 0.23
28 0.2
29 0.22
30 0.22
31 0.21
32 0.2
33 0.2
34 0.24
35 0.28
36 0.32
37 0.31
38 0.35
39 0.32
40 0.33
41 0.32
42 0.3
43 0.23
44 0.17
45 0.14
46 0.08
47 0.08
48 0.05
49 0.05
50 0.04
51 0.09
52 0.09
53 0.1
54 0.11
55 0.12
56 0.13
57 0.14
58 0.24
59 0.26
60 0.3
61 0.33
62 0.34
63 0.33
64 0.32
65 0.33
66 0.29
67 0.26
68 0.26
69 0.32
70 0.4
71 0.41
72 0.42
73 0.44
74 0.41
75 0.46
76 0.5
77 0.47
78 0.46
79 0.53
80 0.6
81 0.63
82 0.71
83 0.72
84 0.72
85 0.76
86 0.7
87 0.68
88 0.6
89 0.56
90 0.49
91 0.42
92 0.35
93 0.27
94 0.25
95 0.19