Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VFB5

Protein Details
Accession K5VFB5    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
8-34PTQGRNRTRSQPTPKRHIRSRPELRLLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
KEGG pco:PHACADRAFT_248493  -  
Amino Acid Sequences MVDPLDEPTQGRNRTRSQPTPKRHIRSRPELRLLLRNSLDFPGNGTSANSLSSELRFFQTRPTPASPRPCHRHSACSNAVSC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.6
3 0.63
4 0.66
5 0.71
6 0.75
7 0.79
8 0.83
9 0.83
10 0.82
11 0.82
12 0.8
13 0.81
14 0.83
15 0.81
16 0.78
17 0.73
18 0.67
19 0.65
20 0.58
21 0.53
22 0.43
23 0.35
24 0.29
25 0.26
26 0.24
27 0.16
28 0.15
29 0.11
30 0.1
31 0.1
32 0.09
33 0.09
34 0.08
35 0.09
36 0.08
37 0.07
38 0.08
39 0.09
40 0.1
41 0.1
42 0.12
43 0.13
44 0.13
45 0.19
46 0.25
47 0.27
48 0.32
49 0.37
50 0.41
51 0.47
52 0.58
53 0.59
54 0.62
55 0.66
56 0.64
57 0.67
58 0.65
59 0.68
60 0.63
61 0.65
62 0.61