Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WBP5

Protein Details
Accession K5WBP5    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MHAARHRRVYRPHYHHHPQFPABasic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 4, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000555  JAMM/MPN+_dom  
IPR037518  MPN  
IPR044098  STAMBP/STALP-like_MPN  
Gene Ontology GO:0061578  F:K63-linked deubiquitinase activity  
GO:0140492  F:metal-dependent deubiquitinase activity  
GO:0070536  P:protein K63-linked deubiquitination  
KEGG pco:PHACADRAFT_160150  -  
Pfam View protein in Pfam  
PF01398  JAB  
PROSITE View protein in PROSITE  
PS50249  MPN  
CDD cd08066  MPN_AMSH_like  
Amino Acid Sequences MHAARHRRVYRPHYHHHPQFPALLVLPVRLPRECLQRFVSIARVNTAKNRETCGLLLGKDKGSKYAVTTLLIPKQHSTSDTCTMDEEELVLQFTEERHLITLGWIHTHPTQSCFMSSVDLHTHSGFQRMLPESFAVVCAPTSNPAFGIFRLTDPGGLQVILDCNAKEAFHPHPDVSVYTDCDNNHVQMKDSALEIVDLRET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.82
4 0.79
5 0.7
6 0.65
7 0.57
8 0.49
9 0.39
10 0.33
11 0.25
12 0.2
13 0.19
14 0.2
15 0.21
16 0.19
17 0.22
18 0.24
19 0.34
20 0.35
21 0.37
22 0.37
23 0.38
24 0.39
25 0.36
26 0.39
27 0.33
28 0.32
29 0.3
30 0.29
31 0.27
32 0.32
33 0.35
34 0.33
35 0.3
36 0.34
37 0.32
38 0.32
39 0.31
40 0.28
41 0.25
42 0.21
43 0.23
44 0.21
45 0.21
46 0.22
47 0.22
48 0.21
49 0.21
50 0.2
51 0.19
52 0.22
53 0.21
54 0.19
55 0.21
56 0.22
57 0.25
58 0.26
59 0.25
60 0.2
61 0.2
62 0.2
63 0.19
64 0.2
65 0.2
66 0.25
67 0.26
68 0.25
69 0.24
70 0.24
71 0.22
72 0.18
73 0.14
74 0.07
75 0.06
76 0.06
77 0.05
78 0.04
79 0.04
80 0.04
81 0.06
82 0.05
83 0.05
84 0.06
85 0.06
86 0.06
87 0.06
88 0.09
89 0.07
90 0.08
91 0.08
92 0.1
93 0.11
94 0.13
95 0.13
96 0.14
97 0.16
98 0.15
99 0.15
100 0.15
101 0.14
102 0.13
103 0.13
104 0.13
105 0.12
106 0.13
107 0.14
108 0.13
109 0.15
110 0.13
111 0.16
112 0.14
113 0.13
114 0.16
115 0.17
116 0.17
117 0.16
118 0.17
119 0.14
120 0.14
121 0.14
122 0.09
123 0.07
124 0.06
125 0.06
126 0.07
127 0.09
128 0.09
129 0.09
130 0.09
131 0.11
132 0.12
133 0.11
134 0.15
135 0.13
136 0.13
137 0.16
138 0.16
139 0.15
140 0.14
141 0.15
142 0.12
143 0.11
144 0.1
145 0.08
146 0.09
147 0.1
148 0.11
149 0.09
150 0.1
151 0.11
152 0.11
153 0.11
154 0.13
155 0.17
156 0.21
157 0.25
158 0.23
159 0.24
160 0.26
161 0.26
162 0.28
163 0.26
164 0.23
165 0.22
166 0.25
167 0.23
168 0.26
169 0.27
170 0.24
171 0.28
172 0.25
173 0.26
174 0.25
175 0.28
176 0.25
177 0.23
178 0.22
179 0.15
180 0.16
181 0.14