Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5XDM4

Protein Details
Accession K5XDM4    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
6-25LNKRSFAKRASPRKDRLPMSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 14.333, mito_nucl 10.832, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR018617  Ima1_N  
Gene Ontology GO:0005637  C:nuclear inner membrane  
KEGG pco:PHACADRAFT_190271  -  
Pfam View protein in Pfam  
PF09779  Ima1_N  
Amino Acid Sequences MHDESLNKRSFAKRASPRKDRLPMSYGTPVFCHTCQTNQMLISNLLSNYLPSPDNTPGCPNNFLPTAPPSKNAIHQSALTAYLPLKKKSDDEIKWHVPMLSACF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.67
3 0.72
4 0.74
5 0.78
6 0.82
7 0.76
8 0.71
9 0.64
10 0.56
11 0.52
12 0.53
13 0.44
14 0.36
15 0.33
16 0.29
17 0.28
18 0.27
19 0.24
20 0.17
21 0.19
22 0.21
23 0.23
24 0.23
25 0.21
26 0.22
27 0.2
28 0.19
29 0.17
30 0.15
31 0.12
32 0.11
33 0.09
34 0.09
35 0.07
36 0.08
37 0.08
38 0.07
39 0.1
40 0.13
41 0.14
42 0.15
43 0.18
44 0.19
45 0.21
46 0.24
47 0.21
48 0.21
49 0.2
50 0.2
51 0.18
52 0.19
53 0.24
54 0.21
55 0.23
56 0.24
57 0.25
58 0.31
59 0.33
60 0.33
61 0.28
62 0.28
63 0.28
64 0.25
65 0.25
66 0.19
67 0.16
68 0.14
69 0.18
70 0.22
71 0.23
72 0.24
73 0.24
74 0.27
75 0.34
76 0.44
77 0.42
78 0.46
79 0.53
80 0.56
81 0.56
82 0.55
83 0.47
84 0.4