Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VDK2

Protein Details
Accession K5VDK2    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
148-169YCSADCMRSDWRRHKKFCRKIEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 11, cyto 8.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
IPR002893  Znf_MYND  
Gene Ontology GO:0046872  F:metal ion binding  
KEGG pco:PHACADRAFT_247401  -  
Pfam View protein in Pfam  
PF13424  TPR_12  
PF13181  TPR_8  
PF01753  zf-MYND  
PROSITE View protein in PROSITE  
PS50865  ZF_MYND_2  
Amino Acid Sequences MSFSTEVRTGQPDPAFIAEFRHGADLHNKGMALERQGKHAEAITVLRNALGLKLETRSGQLGQLDDAEENIRKALEIVSRLSSTYNPAYYRDNLGLVYEMRGDLAEARRIRFGPTPDEYLCSYAKCQPQQLRPLKQLSKCSRCKCILYCSADCMRSDWRRHKKFCRKIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.21
4 0.24
5 0.19
6 0.19
7 0.19
8 0.19
9 0.17
10 0.17
11 0.23
12 0.22
13 0.22
14 0.22
15 0.21
16 0.19
17 0.24
18 0.24
19 0.23
20 0.28
21 0.27
22 0.31
23 0.33
24 0.33
25 0.29
26 0.28
27 0.23
28 0.16
29 0.18
30 0.15
31 0.15
32 0.14
33 0.13
34 0.12
35 0.12
36 0.11
37 0.09
38 0.07
39 0.07
40 0.09
41 0.1
42 0.1
43 0.11
44 0.12
45 0.11
46 0.13
47 0.13
48 0.12
49 0.12
50 0.12
51 0.11
52 0.09
53 0.09
54 0.08
55 0.08
56 0.07
57 0.07
58 0.06
59 0.06
60 0.06
61 0.07
62 0.08
63 0.09
64 0.11
65 0.12
66 0.13
67 0.13
68 0.13
69 0.12
70 0.13
71 0.13
72 0.13
73 0.12
74 0.14
75 0.16
76 0.17
77 0.19
78 0.17
79 0.16
80 0.14
81 0.13
82 0.13
83 0.1
84 0.09
85 0.07
86 0.06
87 0.06
88 0.06
89 0.05
90 0.07
91 0.09
92 0.14
93 0.15
94 0.17
95 0.19
96 0.19
97 0.22
98 0.24
99 0.24
100 0.24
101 0.26
102 0.3
103 0.29
104 0.31
105 0.29
106 0.28
107 0.26
108 0.21
109 0.2
110 0.21
111 0.27
112 0.27
113 0.34
114 0.39
115 0.45
116 0.54
117 0.62
118 0.63
119 0.63
120 0.7
121 0.69
122 0.67
123 0.71
124 0.71
125 0.71
126 0.73
127 0.73
128 0.72
129 0.7
130 0.71
131 0.65
132 0.63
133 0.62
134 0.6
135 0.56
136 0.54
137 0.55
138 0.51
139 0.47
140 0.41
141 0.41
142 0.42
143 0.49
144 0.53
145 0.59
146 0.67
147 0.76
148 0.85
149 0.87