Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VC69

Protein Details
Accession K5VC69   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAPRRNKGKKAPPAPRKRTAAPPAHydrophilic
NLS Segment(s)
PositionSequence
4-19RRNKGKKAPPAPRKRT
155-166PKPKGSAGGGKK
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 9
Family & Domain DBs
KEGG pco:PHACADRAFT_202515  -  
Amino Acid Sequences MAPRRNKGKKAPPAPRKRTAAPPAPTNDETTPTTASTSSTSQPGPNNDTSSVLSSVSPVPGPTTNNISRPNAIELGNGAQPATAMSSTGAGSQGPHIPDIDPALTGSAPMDPATANLMNQVRLLEERLQRAEAAGPLASGGGDRRAAAAAAGSIPKPKGSAGGGKKGFHLIEKMGLGGSGEGKKLYNQLLSTVRELAHAARLDLSMPYCKVRPQDLHNIFATARKIHPFLARFANDWATGEMLKQFMSSVRRYGKRKGYFLYDTEASDVFRRLDDMEDGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.9
3 0.86
4 0.81
5 0.81
6 0.79
7 0.78
8 0.72
9 0.71
10 0.67
11 0.68
12 0.63
13 0.58
14 0.5
15 0.44
16 0.4
17 0.35
18 0.31
19 0.24
20 0.24
21 0.19
22 0.19
23 0.18
24 0.19
25 0.18
26 0.19
27 0.2
28 0.23
29 0.28
30 0.31
31 0.35
32 0.35
33 0.36
34 0.34
35 0.35
36 0.33
37 0.31
38 0.27
39 0.21
40 0.17
41 0.16
42 0.16
43 0.15
44 0.14
45 0.1
46 0.12
47 0.14
48 0.16
49 0.16
50 0.23
51 0.25
52 0.3
53 0.34
54 0.34
55 0.34
56 0.34
57 0.35
58 0.3
59 0.27
60 0.22
61 0.19
62 0.19
63 0.18
64 0.15
65 0.12
66 0.09
67 0.09
68 0.08
69 0.08
70 0.06
71 0.05
72 0.05
73 0.06
74 0.07
75 0.07
76 0.07
77 0.06
78 0.07
79 0.08
80 0.11
81 0.11
82 0.11
83 0.11
84 0.11
85 0.12
86 0.13
87 0.11
88 0.08
89 0.08
90 0.08
91 0.07
92 0.07
93 0.07
94 0.05
95 0.05
96 0.05
97 0.05
98 0.04
99 0.05
100 0.08
101 0.08
102 0.08
103 0.11
104 0.12
105 0.12
106 0.12
107 0.12
108 0.1
109 0.1
110 0.12
111 0.14
112 0.16
113 0.18
114 0.19
115 0.19
116 0.18
117 0.18
118 0.17
119 0.12
120 0.1
121 0.07
122 0.06
123 0.05
124 0.05
125 0.05
126 0.04
127 0.04
128 0.04
129 0.04
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.04
137 0.04
138 0.05
139 0.05
140 0.06
141 0.07
142 0.07
143 0.07
144 0.07
145 0.08
146 0.09
147 0.18
148 0.2
149 0.29
150 0.32
151 0.32
152 0.32
153 0.33
154 0.31
155 0.24
156 0.22
157 0.14
158 0.13
159 0.13
160 0.13
161 0.1
162 0.1
163 0.09
164 0.07
165 0.09
166 0.08
167 0.08
168 0.08
169 0.08
170 0.09
171 0.12
172 0.13
173 0.13
174 0.12
175 0.17
176 0.21
177 0.23
178 0.24
179 0.23
180 0.22
181 0.2
182 0.2
183 0.17
184 0.17
185 0.15
186 0.14
187 0.13
188 0.13
189 0.13
190 0.13
191 0.14
192 0.11
193 0.12
194 0.14
195 0.14
196 0.17
197 0.2
198 0.25
199 0.29
200 0.32
201 0.43
202 0.44
203 0.47
204 0.45
205 0.44
206 0.37
207 0.36
208 0.33
209 0.24
210 0.23
211 0.22
212 0.23
213 0.25
214 0.31
215 0.29
216 0.31
217 0.37
218 0.36
219 0.34
220 0.36
221 0.35
222 0.29
223 0.28
224 0.25
225 0.18
226 0.16
227 0.15
228 0.14
229 0.12
230 0.11
231 0.1
232 0.1
233 0.13
234 0.17
235 0.19
236 0.25
237 0.34
238 0.42
239 0.47
240 0.56
241 0.62
242 0.65
243 0.69
244 0.66
245 0.66
246 0.63
247 0.6
248 0.58
249 0.5
250 0.42
251 0.38
252 0.34
253 0.27
254 0.24
255 0.24
256 0.18
257 0.16
258 0.17
259 0.15
260 0.18