Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WH57

Protein Details
Accession K5WH57    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
171-195GWRFRPEKHKSASRGRGSRKSHTPSBasic
NLS Segment(s)
PositionSequence
175-191RPEKHKSASRGRGSRKS
Subcellular Location(s) mito 10, cyto 6, nucl 5, extr 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005365  Npr3  
Gene Ontology GO:0005774  C:vacuolar membrane  
GO:0051321  P:meiotic cell cycle  
GO:0032007  P:negative regulation of TOR signaling  
KEGG pco:PHACADRAFT_252747  -  
Pfam View protein in Pfam  
PF03666  NPR3  
Amino Acid Sequences MSETLLAVLLVTSSAKGSSLVYRWPPHPATRPRLARPLPTHDATCVHADNPWRAAHASQPSNPCDEYVPEEDDYRWHRLNADRPRSLSFSHGRSRPASRRPSPSKDVKDSLVMEGQHELDIHEHDELLGYSAEFLASLLCPHSAMCHQKFELVVDELAFIGHPVCAEEDGGWRFRPEKHKSASRGRGSRKSHTPSPHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.07
4 0.08
5 0.12
6 0.14
7 0.2
8 0.26
9 0.3
10 0.31
11 0.38
12 0.4
13 0.42
14 0.5
15 0.54
16 0.55
17 0.61
18 0.67
19 0.65
20 0.71
21 0.68
22 0.67
23 0.64
24 0.65
25 0.61
26 0.56
27 0.52
28 0.44
29 0.43
30 0.36
31 0.33
32 0.25
33 0.19
34 0.19
35 0.21
36 0.21
37 0.22
38 0.2
39 0.18
40 0.18
41 0.18
42 0.21
43 0.26
44 0.28
45 0.29
46 0.34
47 0.34
48 0.36
49 0.36
50 0.3
51 0.24
52 0.21
53 0.21
54 0.19
55 0.21
56 0.19
57 0.19
58 0.19
59 0.22
60 0.24
61 0.24
62 0.22
63 0.19
64 0.21
65 0.25
66 0.35
67 0.41
68 0.46
69 0.43
70 0.44
71 0.47
72 0.46
73 0.42
74 0.38
75 0.32
76 0.28
77 0.32
78 0.32
79 0.32
80 0.33
81 0.39
82 0.4
83 0.44
84 0.48
85 0.47
86 0.54
87 0.59
88 0.63
89 0.63
90 0.65
91 0.63
92 0.6
93 0.57
94 0.48
95 0.45
96 0.39
97 0.34
98 0.28
99 0.22
100 0.17
101 0.16
102 0.15
103 0.11
104 0.1
105 0.09
106 0.07
107 0.08
108 0.08
109 0.07
110 0.06
111 0.06
112 0.06
113 0.06
114 0.07
115 0.06
116 0.05
117 0.05
118 0.05
119 0.05
120 0.04
121 0.04
122 0.03
123 0.03
124 0.04
125 0.05
126 0.05
127 0.05
128 0.05
129 0.07
130 0.12
131 0.2
132 0.22
133 0.27
134 0.27
135 0.29
136 0.29
137 0.29
138 0.28
139 0.21
140 0.19
141 0.14
142 0.15
143 0.12
144 0.12
145 0.1
146 0.06
147 0.05
148 0.04
149 0.04
150 0.05
151 0.06
152 0.06
153 0.07
154 0.08
155 0.13
156 0.15
157 0.18
158 0.18
159 0.18
160 0.2
161 0.26
162 0.36
163 0.38
164 0.44
165 0.51
166 0.59
167 0.66
168 0.75
169 0.78
170 0.79
171 0.81
172 0.81
173 0.82
174 0.8
175 0.81
176 0.8
177 0.78
178 0.76