Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5V3L5

Protein Details
Accession K5V3L5    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
97-121APPAWRTVHKRVPRQKKPKALPAPAHydrophilic
NLS Segment(s)
PositionSequence
100-120AWRTVHKRVPRQKKPKALPAP
Subcellular Location(s) mito 14, nucl 8, cyto 4
Family & Domain DBs
KEGG pco:PHACADRAFT_172848  -  
Amino Acid Sequences MSGPPPKGNYGAPPKYINDFSKALAGEVRILLQEVGKLRDERRQLQHEISELMAVRAKYSSGGEYTPDWHPGHREATPPPALPPPPPPDPAEPAGPAPPAWRTVHKRVPRQKKPKALPAPAAAPPPPAIEAPPPSNLPSWAQWRPNPMYAPQPQMAAPPMASPAPPRAGLFGSPSPPPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.48
3 0.52
4 0.45
5 0.4
6 0.36
7 0.33
8 0.34
9 0.32
10 0.27
11 0.22
12 0.2
13 0.17
14 0.16
15 0.15
16 0.1
17 0.11
18 0.1
19 0.09
20 0.11
21 0.11
22 0.14
23 0.16
24 0.18
25 0.19
26 0.26
27 0.31
28 0.36
29 0.42
30 0.45
31 0.46
32 0.48
33 0.48
34 0.43
35 0.39
36 0.32
37 0.25
38 0.19
39 0.16
40 0.15
41 0.12
42 0.11
43 0.1
44 0.1
45 0.09
46 0.1
47 0.1
48 0.09
49 0.1
50 0.11
51 0.11
52 0.14
53 0.14
54 0.18
55 0.17
56 0.16
57 0.18
58 0.19
59 0.22
60 0.2
61 0.22
62 0.19
63 0.24
64 0.26
65 0.24
66 0.23
67 0.23
68 0.23
69 0.21
70 0.25
71 0.25
72 0.26
73 0.27
74 0.28
75 0.27
76 0.3
77 0.3
78 0.26
79 0.22
80 0.19
81 0.18
82 0.16
83 0.13
84 0.11
85 0.1
86 0.11
87 0.12
88 0.18
89 0.23
90 0.31
91 0.4
92 0.46
93 0.55
94 0.63
95 0.73
96 0.77
97 0.81
98 0.83
99 0.84
100 0.83
101 0.84
102 0.83
103 0.78
104 0.72
105 0.65
106 0.6
107 0.52
108 0.48
109 0.37
110 0.29
111 0.24
112 0.2
113 0.18
114 0.14
115 0.13
116 0.14
117 0.18
118 0.19
119 0.21
120 0.21
121 0.22
122 0.22
123 0.23
124 0.22
125 0.23
126 0.27
127 0.31
128 0.35
129 0.36
130 0.43
131 0.46
132 0.48
133 0.46
134 0.41
135 0.43
136 0.43
137 0.46
138 0.4
139 0.37
140 0.32
141 0.32
142 0.32
143 0.25
144 0.2
145 0.15
146 0.16
147 0.15
148 0.15
149 0.15
150 0.18
151 0.2
152 0.21
153 0.21
154 0.22
155 0.23
156 0.24
157 0.28
158 0.27
159 0.26