Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5W4Y2

Protein Details
Accession K5W4Y2    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
29-51LKSDTKIQYNAKRRHWRRTKLNIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11.333, nucl 11, mito 10.5, cyto_nucl 8.333, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR020083  Ribosomal_L39_CS  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pco:PHACADRAFT_98291  -  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
PROSITE View protein in PROSITE  
PS00051  RIBOSOMAL_L39E  
Amino Acid Sequences QPSQKTFRTKRILAKASRQNRPIPQWFRLKSDTKIQYNAKRRHWRRTKLNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.74
3 0.74
4 0.75
5 0.69
6 0.65
7 0.62
8 0.64
9 0.64
10 0.59
11 0.55
12 0.57
13 0.55
14 0.54
15 0.54
16 0.51
17 0.44
18 0.48
19 0.51
20 0.45
21 0.51
22 0.53
23 0.57
24 0.64
25 0.69
26 0.7
27 0.74
28 0.77
29 0.81
30 0.84
31 0.84