Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5VUN5

Protein Details
Accession K5VUN5    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-32VNAFRQGPEKQWRRRFNKLLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 6, cyto 5, pero 5, cyto_pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027806  HARBI1_dom  
Gene Ontology GO:0046872  F:metal ion binding  
KEGG pco:PHACADRAFT_56726  -  
Pfam View protein in Pfam  
PF13359  DDE_Tnp_4  
Amino Acid Sequences PFLLQPFTEPKVNAFRQGPEKQWRRRFNKLLSGKCILVEHTFGMLKGRFPALKVLSTPNNIDDVYRIVKSLMALHNICIDLGDHPEDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.43
4 0.47
5 0.5
6 0.51
7 0.59
8 0.63
9 0.71
10 0.75
11 0.75
12 0.8
13 0.81
14 0.78
15 0.79
16 0.78
17 0.75
18 0.7
19 0.66
20 0.55
21 0.48
22 0.41
23 0.32
24 0.24
25 0.18
26 0.13
27 0.11
28 0.11
29 0.09
30 0.11
31 0.1
32 0.09
33 0.09
34 0.11
35 0.09
36 0.1
37 0.16
38 0.15
39 0.16
40 0.17
41 0.21
42 0.23
43 0.24
44 0.25
45 0.2
46 0.21
47 0.19
48 0.18
49 0.15
50 0.15
51 0.16
52 0.15
53 0.14
54 0.12
55 0.13
56 0.14
57 0.19
58 0.18
59 0.21
60 0.21
61 0.22
62 0.25
63 0.24
64 0.23
65 0.18
66 0.15
67 0.11
68 0.14