Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WCU3

Protein Details
Accession K5WCU3   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-46KVKSQTPKVEKQEKKKTPKGRAKKRMLYNRRFVNHydrophilic
NLS Segment(s)
PositionSequence
12-38GKVKSQTPKVEKQEKKKTPKGRAKKRM
Subcellular Location(s) nucl 12.5, mito_nucl 12, mito 10.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pco:PHACADRAFT_254651  -  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEKQEKKKTPKGRAKKRMLYNRRFVNVTTLPGGKRKMNANPESK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.46
4 0.49
5 0.53
6 0.62
7 0.65
8 0.71
9 0.72
10 0.74
11 0.78
12 0.78
13 0.81
14 0.81
15 0.81
16 0.82
17 0.85
18 0.85
19 0.85
20 0.87
21 0.87
22 0.87
23 0.87
24 0.87
25 0.87
26 0.84
27 0.82
28 0.78
29 0.72
30 0.65
31 0.55
32 0.52
33 0.44
34 0.39
35 0.34
36 0.29
37 0.27
38 0.31
39 0.34
40 0.29
41 0.31
42 0.34
43 0.4
44 0.47