Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WF74

Protein Details
Accession K5WF74   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
19-39DVDRDKEKEKEKDKNSKSKGABasic
NLS Segment(s)
PositionSequence
26-39KEKEKDKNSKSKGA
Subcellular Location(s) nucl 13, cyto_nucl 10.5, mito 6, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR045072  MKRN-like  
IPR000571  Znf_CCCH  
IPR036855  Znf_CCCH_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0061630  F:ubiquitin protein ligase activity  
GO:0000209  P:protein polyubiquitination  
KEGG pco:PHACADRAFT_251845  -  
Pfam View protein in Pfam  
PF00642  zf-CCCH  
PF14608  zf-CCCH_2  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MHDPDKGLKEEDSQDLSRDVDRDKEKEKEKDKNSKSKGAAKTKDLSHVPCKFFKVGSCTAGSSCPFSHTVLEPGQPKEVCAWFVKGNCKFGHKCALAHVLPGQSMSMDRKNKKAAQAAASAGNSSGREGHRSGRSQKSGGQGSQNSSSGSRGSLLSGSTAPTRSLSSSRSGIPMPLKATLSPSAPAPPVQNTDFASFGLPDESNKLPSAPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.3
4 0.27
5 0.25
6 0.22
7 0.24
8 0.29
9 0.32
10 0.36
11 0.43
12 0.49
13 0.57
14 0.64
15 0.66
16 0.7
17 0.76
18 0.8
19 0.82
20 0.8
21 0.8
22 0.77
23 0.76
24 0.76
25 0.76
26 0.72
27 0.67
28 0.67
29 0.6
30 0.62
31 0.56
32 0.52
33 0.5
34 0.52
35 0.51
36 0.48
37 0.49
38 0.43
39 0.41
40 0.38
41 0.36
42 0.32
43 0.31
44 0.29
45 0.26
46 0.26
47 0.27
48 0.24
49 0.2
50 0.17
51 0.17
52 0.16
53 0.16
54 0.17
55 0.16
56 0.19
57 0.17
58 0.21
59 0.22
60 0.22
61 0.26
62 0.23
63 0.23
64 0.22
65 0.22
66 0.2
67 0.18
68 0.19
69 0.17
70 0.21
71 0.29
72 0.28
73 0.31
74 0.3
75 0.35
76 0.33
77 0.32
78 0.38
79 0.31
80 0.29
81 0.28
82 0.33
83 0.27
84 0.27
85 0.26
86 0.18
87 0.16
88 0.16
89 0.13
90 0.06
91 0.07
92 0.09
93 0.14
94 0.2
95 0.22
96 0.26
97 0.31
98 0.34
99 0.38
100 0.41
101 0.38
102 0.35
103 0.36
104 0.34
105 0.31
106 0.28
107 0.23
108 0.17
109 0.15
110 0.11
111 0.09
112 0.11
113 0.09
114 0.12
115 0.13
116 0.18
117 0.23
118 0.27
119 0.34
120 0.39
121 0.41
122 0.4
123 0.43
124 0.45
125 0.43
126 0.41
127 0.4
128 0.34
129 0.35
130 0.36
131 0.33
132 0.27
133 0.24
134 0.23
135 0.17
136 0.15
137 0.13
138 0.1
139 0.1
140 0.1
141 0.09
142 0.1
143 0.1
144 0.11
145 0.11
146 0.12
147 0.12
148 0.12
149 0.13
150 0.14
151 0.16
152 0.17
153 0.2
154 0.21
155 0.22
156 0.24
157 0.23
158 0.25
159 0.25
160 0.27
161 0.25
162 0.25
163 0.25
164 0.23
165 0.26
166 0.25
167 0.24
168 0.21
169 0.2
170 0.2
171 0.2
172 0.22
173 0.21
174 0.22
175 0.25
176 0.26
177 0.28
178 0.27
179 0.29
180 0.27
181 0.25
182 0.23
183 0.18
184 0.17
185 0.17
186 0.14
187 0.13
188 0.17
189 0.18
190 0.19
191 0.2