Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WJ36

Protein Details
Accession K5WJ36    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
149-168DPNRPKPKTGPAWRRERDEVBasic
NLS Segment(s)
Subcellular Location(s) cyto 12, cyto_nucl 9.833, cyto_pero 8.833, nucl 6.5, pero 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037730  IMP2  
IPR036286  LexA/Signal_pep-like_sf  
IPR000223  Pept_S26A_signal_pept_1  
IPR019533  Peptidase_S26  
Gene Ontology GO:0042720  C:mitochondrial inner membrane peptidase complex  
GO:0004252  F:serine-type endopeptidase activity  
GO:0006627  P:protein processing involved in protein targeting to mitochondrion  
GO:0006465  P:signal peptide processing  
KEGG pco:PHACADRAFT_86447  -  
Pfam View protein in Pfam  
PF10502  Peptidase_S26  
CDD cd06530  S26_SPase_I  
Amino Acid Sequences MSAMVWLPTGIAFNEYFYSLKYVAGRSMQPTLNPDDSSWQDIVLFDHFTVNWLQKYERGDIVALKSPHEGKLIVKRIVALPGDTIKTLPPYPDAEVHIPEGHAWVEGDEPFRSEDSNYFGPIPLGLVQSKLSVIVWPLNRTGPILLPGDPNRPKPKTGPAWRRERDEVDRQTRRQARVTEALNSPRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.13
4 0.12
5 0.16
6 0.14
7 0.16
8 0.17
9 0.17
10 0.19
11 0.22
12 0.23
13 0.23
14 0.28
15 0.27
16 0.26
17 0.28
18 0.31
19 0.31
20 0.3
21 0.27
22 0.27
23 0.28
24 0.29
25 0.26
26 0.2
27 0.17
28 0.17
29 0.18
30 0.14
31 0.13
32 0.09
33 0.1
34 0.1
35 0.11
36 0.12
37 0.13
38 0.13
39 0.14
40 0.14
41 0.17
42 0.2
43 0.22
44 0.21
45 0.19
46 0.19
47 0.19
48 0.21
49 0.24
50 0.21
51 0.19
52 0.2
53 0.2
54 0.21
55 0.2
56 0.18
57 0.14
58 0.24
59 0.29
60 0.29
61 0.27
62 0.27
63 0.27
64 0.29
65 0.26
66 0.17
67 0.12
68 0.12
69 0.13
70 0.12
71 0.11
72 0.09
73 0.11
74 0.11
75 0.1
76 0.1
77 0.11
78 0.13
79 0.14
80 0.16
81 0.15
82 0.16
83 0.17
84 0.15
85 0.13
86 0.12
87 0.11
88 0.08
89 0.07
90 0.06
91 0.05
92 0.05
93 0.06
94 0.08
95 0.07
96 0.08
97 0.08
98 0.09
99 0.09
100 0.09
101 0.09
102 0.13
103 0.14
104 0.14
105 0.14
106 0.14
107 0.14
108 0.13
109 0.13
110 0.09
111 0.09
112 0.08
113 0.09
114 0.09
115 0.1
116 0.1
117 0.09
118 0.08
119 0.07
120 0.08
121 0.12
122 0.14
123 0.16
124 0.17
125 0.18
126 0.18
127 0.19
128 0.18
129 0.14
130 0.15
131 0.15
132 0.15
133 0.19
134 0.22
135 0.3
136 0.33
137 0.39
138 0.45
139 0.46
140 0.47
141 0.46
142 0.54
143 0.56
144 0.63
145 0.66
146 0.67
147 0.75
148 0.78
149 0.8
150 0.76
151 0.73
152 0.7
153 0.69
154 0.7
155 0.7
156 0.74
157 0.69
158 0.73
159 0.73
160 0.7
161 0.67
162 0.62
163 0.58
164 0.58
165 0.58
166 0.54
167 0.54