Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5WHJ3

Protein Details
Accession K5WHJ3    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
46-66VSFHRPKTLRLPRNPKYPRKSHydrophilic
NLS Segment(s)
PositionSequence
8-65KAKGSAPKASAQNAKAKAAKKAALAGTNSQAHRKKRTSVSFHRPKTLRLPRNPKYPRK
Subcellular Location(s) nucl 18, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR019985  Ribosomal_L23  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001014  Ribosomal_L23/L25_CS  
IPR005633  Ribosomal_L23/L25_N  
IPR013025  Ribosomal_L25/23  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pco:PHACADRAFT_214214  -  
Pfam View protein in Pfam  
PF00276  Ribosomal_L23  
PF03939  Ribosomal_L23eN  
PROSITE View protein in PROSITE  
PS00050  RIBOSOMAL_L23  
Amino Acid Sequences MASSKTQKAKGSAPKASAQNAKAKAAKKAALAGTNSQAHRKKRTSVSFHRPKTLRLPRNPKYPRKSIPHVPRMDQFRTIVSPLNTESAMKKIEEHNTLVFIVDIQANKRQIKDAVKKLYDVQAAKVNTLIRPDGKKKAYVRLTADHDALDVANKIGFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.59
3 0.61
4 0.58
5 0.52
6 0.51
7 0.48
8 0.5
9 0.49
10 0.47
11 0.47
12 0.46
13 0.46
14 0.38
15 0.41
16 0.38
17 0.38
18 0.37
19 0.33
20 0.33
21 0.35
22 0.35
23 0.37
24 0.4
25 0.41
26 0.48
27 0.49
28 0.51
29 0.55
30 0.63
31 0.65
32 0.69
33 0.74
34 0.76
35 0.76
36 0.77
37 0.69
38 0.63
39 0.64
40 0.65
41 0.63
42 0.62
43 0.69
44 0.67
45 0.77
46 0.82
47 0.81
48 0.77
49 0.77
50 0.74
51 0.72
52 0.72
53 0.71
54 0.72
55 0.72
56 0.68
57 0.62
58 0.59
59 0.57
60 0.52
61 0.44
62 0.34
63 0.26
64 0.24
65 0.23
66 0.21
67 0.15
68 0.14
69 0.13
70 0.14
71 0.12
72 0.12
73 0.11
74 0.11
75 0.12
76 0.1
77 0.11
78 0.14
79 0.18
80 0.2
81 0.21
82 0.2
83 0.2
84 0.2
85 0.18
86 0.15
87 0.1
88 0.08
89 0.08
90 0.08
91 0.09
92 0.14
93 0.18
94 0.2
95 0.2
96 0.22
97 0.25
98 0.34
99 0.41
100 0.46
101 0.5
102 0.5
103 0.51
104 0.51
105 0.52
106 0.48
107 0.4
108 0.34
109 0.32
110 0.31
111 0.3
112 0.3
113 0.26
114 0.21
115 0.23
116 0.23
117 0.21
118 0.28
119 0.33
120 0.4
121 0.41
122 0.48
123 0.49
124 0.56
125 0.58
126 0.58
127 0.58
128 0.56
129 0.61
130 0.57
131 0.54
132 0.44
133 0.37
134 0.3
135 0.25
136 0.2
137 0.13
138 0.1