Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VRK5

Protein Details
Accession K5VRK5   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MPPRNHGKKRAAKTPQKIPKRQKMASKHVKFBasic
NLS Segment(s)
PositionSequence
4-26RNHGKKRAAKTPQKIPKRQKMAS
58-64KKRGGRK
Subcellular Location(s) nucl 17.5, mito_nucl 11.5, cyto 5, mito 4.5
Family & Domain DBs
KEGG pco:PHACADRAFT_201635  -  
Amino Acid Sequences MPPRNHGKKRAAKTPQKIPKRQKMASKHVKFDNGAVMTQFRLSGEFSSEDTVQDSPAKKRGGRKGPGVQDVAEGEVLMAFVLPRRDRANHQHDPSGESSINKCMVTNTANCYALMFGSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.85
4 0.88
5 0.87
6 0.87
7 0.87
8 0.84
9 0.82
10 0.82
11 0.82
12 0.83
13 0.79
14 0.76
15 0.71
16 0.69
17 0.6
18 0.52
19 0.49
20 0.38
21 0.32
22 0.26
23 0.22
24 0.17
25 0.17
26 0.15
27 0.08
28 0.08
29 0.08
30 0.08
31 0.09
32 0.1
33 0.1
34 0.12
35 0.12
36 0.12
37 0.12
38 0.12
39 0.1
40 0.13
41 0.14
42 0.13
43 0.19
44 0.21
45 0.22
46 0.29
47 0.38
48 0.44
49 0.46
50 0.52
51 0.54
52 0.57
53 0.59
54 0.53
55 0.44
56 0.35
57 0.31
58 0.24
59 0.17
60 0.11
61 0.07
62 0.05
63 0.05
64 0.04
65 0.03
66 0.02
67 0.04
68 0.08
69 0.09
70 0.12
71 0.15
72 0.18
73 0.24
74 0.34
75 0.42
76 0.47
77 0.51
78 0.54
79 0.51
80 0.53
81 0.49
82 0.44
83 0.36
84 0.29
85 0.27
86 0.26
87 0.28
88 0.23
89 0.22
90 0.18
91 0.21
92 0.22
93 0.24
94 0.25
95 0.28
96 0.29
97 0.29
98 0.28
99 0.25