Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VJB3

Protein Details
Accession K5VJB3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
21-40TSPTPPTKCRDRVRYRGQLLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, plas 4, extr 4, cyto 2.5, cyto_nucl 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG pco:PHACADRAFT_263495  -  
Amino Acid Sequences MHGSFPLKGGLRSFAFYLGATSPTPPTKCRDRVRYRGQLLEYIAQPQAFFLKAFFIIVTTCHAIVILLLHHAQPDTTSRLFPLLCANPSPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.18
4 0.18
5 0.13
6 0.14
7 0.12
8 0.13
9 0.15
10 0.19
11 0.2
12 0.2
13 0.24
14 0.31
15 0.4
16 0.47
17 0.55
18 0.6
19 0.68
20 0.76
21 0.8
22 0.75
23 0.71
24 0.63
25 0.56
26 0.48
27 0.41
28 0.31
29 0.23
30 0.21
31 0.15
32 0.14
33 0.11
34 0.1
35 0.08
36 0.07
37 0.06
38 0.06
39 0.06
40 0.07
41 0.06
42 0.06
43 0.05
44 0.06
45 0.09
46 0.09
47 0.09
48 0.08
49 0.08
50 0.08
51 0.08
52 0.08
53 0.05
54 0.06
55 0.06
56 0.07
57 0.07
58 0.07
59 0.07
60 0.08
61 0.11
62 0.15
63 0.16
64 0.16
65 0.17
66 0.2
67 0.2
68 0.2
69 0.25
70 0.25
71 0.26