Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5VL95

Protein Details
Accession K5VL95    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-29PVPAAPKRAAPPRRKAPKSPSPAPPPPAHydrophilic
NLS Segment(s)
PositionSequence
7-23PKRAAPPRRKAPKSPSP
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
KEGG pco:PHACADRAFT_262703  -  
Amino Acid Sequences MPVPAAPKRAAPPRRKAPKSPSPAPPPPAAEQVFEDAAEVSQSPAPGTPQLTSDDGSKELQEAVRKSKEDEGALGLEPVQKRKSVHEPPKAKEEPVHEEQQPTREVQDNIDELALDNERERGQNEESKQAPNTAHAEEHVEEAQGPAPTDESPLIEERRAVEELEFTGEQPAQAEEEEDEDARRKRIAERLRQQGGFNPFAAPPTPSRKTTVDIPKSPEKDLAFDEVDVEAKDIDAPPPALPEATNIARRESLDLSAPSATSLASPPVPPIATRPVPERKASVPTVPEEQRGYAGESESNYEDEEDDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.84
4 0.83
5 0.84
6 0.84
7 0.83
8 0.81
9 0.8
10 0.81
11 0.76
12 0.72
13 0.66
14 0.6
15 0.6
16 0.51
17 0.43
18 0.37
19 0.36
20 0.31
21 0.26
22 0.23
23 0.15
24 0.14
25 0.12
26 0.1
27 0.08
28 0.09
29 0.09
30 0.09
31 0.09
32 0.11
33 0.13
34 0.15
35 0.14
36 0.14
37 0.18
38 0.19
39 0.19
40 0.2
41 0.19
42 0.19
43 0.19
44 0.18
45 0.15
46 0.16
47 0.17
48 0.2
49 0.22
50 0.27
51 0.32
52 0.32
53 0.34
54 0.39
55 0.4
56 0.35
57 0.33
58 0.28
59 0.25
60 0.24
61 0.21
62 0.16
63 0.16
64 0.16
65 0.19
66 0.17
67 0.18
68 0.19
69 0.25
70 0.34
71 0.41
72 0.5
73 0.57
74 0.63
75 0.64
76 0.73
77 0.69
78 0.6
79 0.54
80 0.49
81 0.47
82 0.43
83 0.45
84 0.36
85 0.38
86 0.38
87 0.38
88 0.33
89 0.26
90 0.23
91 0.24
92 0.23
93 0.21
94 0.23
95 0.2
96 0.19
97 0.19
98 0.16
99 0.11
100 0.12
101 0.11
102 0.07
103 0.07
104 0.08
105 0.08
106 0.09
107 0.1
108 0.12
109 0.15
110 0.2
111 0.21
112 0.26
113 0.27
114 0.29
115 0.28
116 0.28
117 0.25
118 0.22
119 0.23
120 0.18
121 0.17
122 0.15
123 0.17
124 0.15
125 0.16
126 0.13
127 0.1
128 0.09
129 0.09
130 0.11
131 0.08
132 0.08
133 0.06
134 0.07
135 0.07
136 0.08
137 0.08
138 0.06
139 0.07
140 0.09
141 0.1
142 0.1
143 0.1
144 0.1
145 0.13
146 0.13
147 0.12
148 0.1
149 0.1
150 0.1
151 0.12
152 0.11
153 0.08
154 0.09
155 0.09
156 0.08
157 0.08
158 0.08
159 0.06
160 0.06
161 0.06
162 0.05
163 0.06
164 0.07
165 0.07
166 0.07
167 0.1
168 0.12
169 0.12
170 0.13
171 0.13
172 0.16
173 0.24
174 0.32
175 0.39
176 0.47
177 0.55
178 0.6
179 0.6
180 0.57
181 0.55
182 0.52
183 0.44
184 0.35
185 0.27
186 0.22
187 0.21
188 0.22
189 0.17
190 0.15
191 0.21
192 0.24
193 0.24
194 0.29
195 0.3
196 0.32
197 0.4
198 0.47
199 0.47
200 0.47
201 0.52
202 0.56
203 0.57
204 0.55
205 0.51
206 0.41
207 0.35
208 0.33
209 0.32
210 0.24
211 0.21
212 0.21
213 0.16
214 0.16
215 0.14
216 0.12
217 0.07
218 0.06
219 0.07
220 0.07
221 0.07
222 0.08
223 0.09
224 0.09
225 0.11
226 0.11
227 0.11
228 0.1
229 0.12
230 0.16
231 0.18
232 0.24
233 0.23
234 0.25
235 0.26
236 0.27
237 0.29
238 0.25
239 0.22
240 0.21
241 0.21
242 0.21
243 0.2
244 0.2
245 0.16
246 0.14
247 0.13
248 0.09
249 0.09
250 0.1
251 0.11
252 0.11
253 0.12
254 0.15
255 0.16
256 0.15
257 0.18
258 0.24
259 0.27
260 0.29
261 0.35
262 0.42
263 0.45
264 0.48
265 0.48
266 0.43
267 0.46
268 0.47
269 0.46
270 0.4
271 0.4
272 0.45
273 0.43
274 0.43
275 0.39
276 0.36
277 0.33
278 0.31
279 0.31
280 0.24
281 0.23
282 0.21
283 0.2
284 0.23
285 0.22
286 0.21
287 0.18
288 0.17