Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5W4Q6

Protein Details
Accession K5W4Q6    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
67-95KEKLQVNREKKQQRTEQRERNGRERKGKSBasic
NLS Segment(s)
PositionSequence
16-17KK
74-95REKKQQRTEQRERNGRERKGKS
Subcellular Location(s) nucl 17, cyto 6, mito 3, cyto_pero 3
Family & Domain DBs
KEGG pco:PHACADRAFT_248965  -  
Amino Acid Sequences MEWRTQSLAGGHKRTKKATKRGEVFQIRSTMRSKYPGWHTNLGTIKAALKSKPEWAAWTQQLVGERKEKLQVNREKKQQRTEQRERNGRERKGKSAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.67
3 0.69
4 0.72
5 0.74
6 0.78
7 0.76
8 0.77
9 0.79
10 0.77
11 0.71
12 0.64
13 0.6
14 0.5
15 0.47
16 0.43
17 0.36
18 0.3
19 0.31
20 0.28
21 0.28
22 0.36
23 0.4
24 0.43
25 0.46
26 0.44
27 0.46
28 0.48
29 0.43
30 0.34
31 0.28
32 0.24
33 0.21
34 0.22
35 0.15
36 0.14
37 0.14
38 0.17
39 0.2
40 0.19
41 0.19
42 0.2
43 0.25
44 0.24
45 0.25
46 0.21
47 0.19
48 0.24
49 0.24
50 0.24
51 0.22
52 0.22
53 0.22
54 0.28
55 0.31
56 0.32
57 0.4
58 0.48
59 0.53
60 0.6
61 0.69
62 0.72
63 0.74
64 0.78
65 0.78
66 0.79
67 0.8
68 0.83
69 0.83
70 0.85
71 0.88
72 0.85
73 0.85
74 0.85
75 0.83
76 0.83
77 0.78