Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4R064

Protein Details
Accession C4R064    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
113-137ILQEEKKRPKPQKPVYESRKKPKTABasic
NLS Segment(s)
PositionSequence
118-136KKRPKPQKPVYESRKKPKT
Subcellular Location(s) nucl 23, cyto_nucl 13.833, mito_nucl 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR039577  Rad18  
IPR006642  Rad18_UBZ4  
IPR003034  SAP_dom  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
IPR017907  Znf_RING_CS  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0003697  F:single-stranded DNA binding  
GO:0061630  F:ubiquitin protein ligase activity  
GO:0006301  P:postreplication repair  
GO:0006513  P:protein monoubiquitination  
KEGG ppa:PAS_chr2-1_0274  -  
Pfam View protein in Pfam  
PF13923  zf-C3HC4_2  
PROSITE View protein in PROSITE  
PS50800  SAP  
PS00518  ZF_RING_1  
PS50089  ZF_RING_2  
PS51908  ZF_UBZ4  
Amino Acid Sequences MDATVGNIGSISDPSDWLGTKVPKLFDLESMLSCHICKETLKAPVMTQCGHCFCSLCIRRYLKVNQECPLCHEVQYESNLVKVLLLDSIGKWFISNRSQLLAKLNADDDSVIILQEEKKRPKPQKPVYESRKKPKTAGFGKSVPSREEMVECPICGEFMSAEELQGDHIDICLVGKDNKDEKEEDSKEDREHHESAQKVPEKDIVVTIPKDQDFQVQKAVDMKRLAKLDFASLSTNKVKEKLAQLRLPTSGTRAQLEARYVEYSNLYNSNLDSANPKDSVVLRDKLEQWEALSEIDNNKSNHTEKFNRSAWVKTHGNEFRELIQAAKKTHFSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.13
3 0.13
4 0.14
5 0.2
6 0.22
7 0.26
8 0.3
9 0.31
10 0.31
11 0.35
12 0.34
13 0.31
14 0.33
15 0.31
16 0.27
17 0.29
18 0.28
19 0.24
20 0.22
21 0.21
22 0.15
23 0.15
24 0.14
25 0.16
26 0.21
27 0.28
28 0.32
29 0.32
30 0.33
31 0.38
32 0.4
33 0.38
34 0.35
35 0.33
36 0.33
37 0.33
38 0.31
39 0.26
40 0.23
41 0.32
42 0.35
43 0.32
44 0.38
45 0.41
46 0.43
47 0.49
48 0.56
49 0.55
50 0.58
51 0.59
52 0.56
53 0.58
54 0.55
55 0.54
56 0.52
57 0.42
58 0.34
59 0.31
60 0.27
61 0.26
62 0.28
63 0.24
64 0.19
65 0.19
66 0.18
67 0.16
68 0.14
69 0.11
70 0.08
71 0.06
72 0.07
73 0.07
74 0.06
75 0.08
76 0.09
77 0.08
78 0.08
79 0.09
80 0.13
81 0.16
82 0.19
83 0.18
84 0.21
85 0.22
86 0.23
87 0.27
88 0.27
89 0.23
90 0.22
91 0.21
92 0.19
93 0.18
94 0.16
95 0.12
96 0.09
97 0.08
98 0.07
99 0.06
100 0.06
101 0.1
102 0.17
103 0.24
104 0.28
105 0.36
106 0.45
107 0.54
108 0.63
109 0.7
110 0.73
111 0.77
112 0.79
113 0.83
114 0.84
115 0.86
116 0.85
117 0.84
118 0.83
119 0.74
120 0.69
121 0.64
122 0.64
123 0.61
124 0.59
125 0.54
126 0.48
127 0.5
128 0.51
129 0.48
130 0.39
131 0.33
132 0.29
133 0.24
134 0.23
135 0.19
136 0.2
137 0.18
138 0.17
139 0.15
140 0.14
141 0.13
142 0.11
143 0.1
144 0.05
145 0.05
146 0.08
147 0.07
148 0.07
149 0.07
150 0.07
151 0.07
152 0.07
153 0.07
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.04
161 0.06
162 0.06
163 0.1
164 0.14
165 0.16
166 0.18
167 0.19
168 0.21
169 0.29
170 0.3
171 0.31
172 0.32
173 0.32
174 0.31
175 0.34
176 0.35
177 0.3
178 0.3
179 0.28
180 0.28
181 0.28
182 0.29
183 0.33
184 0.34
185 0.3
186 0.29
187 0.31
188 0.27
189 0.26
190 0.25
191 0.18
192 0.17
193 0.17
194 0.18
195 0.17
196 0.16
197 0.17
198 0.16
199 0.22
200 0.22
201 0.23
202 0.27
203 0.24
204 0.25
205 0.31
206 0.31
207 0.28
208 0.28
209 0.28
210 0.27
211 0.29
212 0.29
213 0.24
214 0.24
215 0.22
216 0.2
217 0.2
218 0.19
219 0.17
220 0.21
221 0.22
222 0.24
223 0.22
224 0.23
225 0.23
226 0.24
227 0.33
228 0.38
229 0.42
230 0.44
231 0.46
232 0.47
233 0.47
234 0.45
235 0.36
236 0.31
237 0.28
238 0.25
239 0.24
240 0.22
241 0.23
242 0.24
243 0.25
244 0.22
245 0.2
246 0.2
247 0.19
248 0.19
249 0.18
250 0.17
251 0.17
252 0.18
253 0.17
254 0.15
255 0.14
256 0.16
257 0.15
258 0.15
259 0.16
260 0.17
261 0.2
262 0.19
263 0.19
264 0.19
265 0.21
266 0.26
267 0.28
268 0.3
269 0.28
270 0.33
271 0.36
272 0.37
273 0.37
274 0.32
275 0.27
276 0.25
277 0.24
278 0.2
279 0.18
280 0.16
281 0.17
282 0.21
283 0.26
284 0.24
285 0.26
286 0.3
287 0.31
288 0.35
289 0.4
290 0.44
291 0.45
292 0.53
293 0.53
294 0.55
295 0.55
296 0.56
297 0.51
298 0.51
299 0.49
300 0.42
301 0.49
302 0.49
303 0.49
304 0.47
305 0.45
306 0.4
307 0.4
308 0.38
309 0.31
310 0.31
311 0.33
312 0.33
313 0.36