Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5X383

Protein Details
Accession K5X383    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
31-55GNNVPFSKKKTRRTWLPNVHNQRLFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034704  L28p-like  
IPR026569  Ribo_L28/L24  
IPR037147  Ribo_L28/L24_sf  
IPR001383  Ribosomal_L28  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pco:PHACADRAFT_93058  -  
Pfam View protein in Pfam  
PF00830  Ribosomal_L28  
Amino Acid Sequences MFPTLRLCEAISAPFKRAQLGLFGGKTRQSGNNVPFSKKKTRRTWLPNVHNQRLFSETLQDYIRVKVTARALKTIKKHGGIDKYVMKTKPELLGWEGMRIRVMLRERQIAQGVVDIPAAANTPASPAVETVAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.3
4 0.29
5 0.24
6 0.21
7 0.24
8 0.26
9 0.23
10 0.24
11 0.24
12 0.25
13 0.26
14 0.24
15 0.24
16 0.24
17 0.3
18 0.33
19 0.41
20 0.42
21 0.45
22 0.48
23 0.5
24 0.56
25 0.57
26 0.63
27 0.63
28 0.69
29 0.75
30 0.79
31 0.84
32 0.84
33 0.84
34 0.84
35 0.83
36 0.81
37 0.74
38 0.66
39 0.56
40 0.48
41 0.4
42 0.3
43 0.26
44 0.19
45 0.18
46 0.18
47 0.18
48 0.16
49 0.15
50 0.16
51 0.11
52 0.11
53 0.13
54 0.18
55 0.2
56 0.2
57 0.25
58 0.26
59 0.3
60 0.34
61 0.38
62 0.37
63 0.36
64 0.38
65 0.38
66 0.42
67 0.39
68 0.4
69 0.38
70 0.37
71 0.4
72 0.38
73 0.33
74 0.29
75 0.3
76 0.29
77 0.24
78 0.23
79 0.2
80 0.25
81 0.24
82 0.28
83 0.25
84 0.22
85 0.21
86 0.19
87 0.18
88 0.17
89 0.2
90 0.21
91 0.24
92 0.3
93 0.31
94 0.35
95 0.36
96 0.32
97 0.29
98 0.26
99 0.23
100 0.18
101 0.16
102 0.12
103 0.1
104 0.09
105 0.1
106 0.07
107 0.06
108 0.05
109 0.08
110 0.09
111 0.1
112 0.1
113 0.09