Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5V561

Protein Details
Accession K5V561    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
49-68RENSSHAKCKKRRSWPPSTDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 6, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR046451  HgmA_C  
IPR014710  RmlC-like_jellyroll  
Gene Ontology GO:0046872  F:metal ion binding  
KEGG pco:PHACADRAFT_192917  -  
Pfam View protein in Pfam  
PF04209  HgmA_C  
Amino Acid Sequences MLQDIQLSAHNFSQSSEMWGFVEQTRRPAYFHRNTIPETLGLIYGQYGRENSSHAKCKKRRSWPPSTDEDIPEREPGTSDGLHAMFLEDEIEAERNGTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.2
3 0.18
4 0.16
5 0.16
6 0.16
7 0.17
8 0.17
9 0.24
10 0.19
11 0.24
12 0.27
13 0.27
14 0.28
15 0.31
16 0.39
17 0.39
18 0.45
19 0.45
20 0.45
21 0.46
22 0.47
23 0.42
24 0.33
25 0.26
26 0.2
27 0.14
28 0.11
29 0.09
30 0.07
31 0.07
32 0.07
33 0.06
34 0.06
35 0.07
36 0.07
37 0.09
38 0.13
39 0.17
40 0.25
41 0.3
42 0.4
43 0.45
44 0.55
45 0.63
46 0.7
47 0.76
48 0.75
49 0.81
50 0.79
51 0.79
52 0.76
53 0.72
54 0.65
55 0.57
56 0.51
57 0.44
58 0.37
59 0.33
60 0.26
61 0.21
62 0.19
63 0.17
64 0.18
65 0.14
66 0.14
67 0.15
68 0.15
69 0.15
70 0.13
71 0.13
72 0.09
73 0.09
74 0.09
75 0.05
76 0.06
77 0.07
78 0.08
79 0.08