Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VRQ5

Protein Details
Accession K5VRQ5    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
22-46DNPDTARKKMKMKKGKKVTEGSKKIBasic
NLS Segment(s)
PositionSequence
28-40RKKMKMKKGKKVT
Subcellular Location(s) cyto_nucl 11, nucl 10.5, cyto 8.5, pero 5
Family & Domain DBs
KEGG pco:PHACADRAFT_106917  -  
Amino Acid Sequences MAEYNWCFPELKDEDVQSLEADNPDTARKKMKMKKGKKVTEGSKKISWTWCGTDADDELNSSVCVEWLKARARFLQWHEELLLLPEEIRWTIKTHVFKAKWWVSQAALHTDVDLALREGLIAYAARQAAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.3
4 0.21
5 0.18
6 0.15
7 0.12
8 0.12
9 0.11
10 0.11
11 0.15
12 0.18
13 0.19
14 0.25
15 0.29
16 0.38
17 0.46
18 0.55
19 0.61
20 0.69
21 0.78
22 0.81
23 0.85
24 0.83
25 0.84
26 0.83
27 0.83
28 0.8
29 0.75
30 0.68
31 0.61
32 0.56
33 0.51
34 0.44
35 0.36
36 0.32
37 0.3
38 0.27
39 0.26
40 0.24
41 0.21
42 0.19
43 0.15
44 0.13
45 0.09
46 0.08
47 0.07
48 0.06
49 0.05
50 0.04
51 0.04
52 0.04
53 0.06
54 0.1
55 0.14
56 0.16
57 0.17
58 0.2
59 0.22
60 0.27
61 0.29
62 0.33
63 0.29
64 0.29
65 0.28
66 0.26
67 0.24
68 0.2
69 0.17
70 0.08
71 0.08
72 0.06
73 0.07
74 0.07
75 0.08
76 0.08
77 0.09
78 0.13
79 0.19
80 0.23
81 0.28
82 0.37
83 0.37
84 0.39
85 0.46
86 0.49
87 0.47
88 0.45
89 0.43
90 0.35
91 0.38
92 0.38
93 0.33
94 0.29
95 0.25
96 0.22
97 0.2
98 0.18
99 0.15
100 0.13
101 0.09
102 0.07
103 0.07
104 0.07
105 0.06
106 0.06
107 0.07
108 0.06
109 0.06
110 0.1