Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WH88

Protein Details
Accession K5WH88    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-25IYTRHKAEQKAIKQKKNLWYPFKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, mito 9, cyto_nucl 8.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041078  Plavaka  
KEGG pco:PHACADRAFT_106209  -  
Pfam View protein in Pfam  
PF18759  Plavaka  
Amino Acid Sequences MEIYTRHKAEQKAIKQKKNLWYPFKDAKEWELAKWLLASSLSQKKIDRFLKLETMSLNRHHQHLSFKNKGGFFKLVDKLSRGPRWKCEMFAADGDVVDERTGKRKVQTFELWKWDPVECIKELIGNPAFKEHIQYAPEHTFKDHEGLKPIVDEMWTAKQWVRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.75
3 0.8
4 0.81
5 0.81
6 0.8
7 0.78
8 0.74
9 0.74
10 0.76
11 0.72
12 0.66
13 0.58
14 0.51
15 0.52
16 0.47
17 0.39
18 0.36
19 0.32
20 0.28
21 0.27
22 0.24
23 0.15
24 0.14
25 0.14
26 0.15
27 0.22
28 0.24
29 0.26
30 0.28
31 0.3
32 0.39
33 0.43
34 0.4
35 0.35
36 0.37
37 0.42
38 0.4
39 0.39
40 0.32
41 0.32
42 0.29
43 0.3
44 0.33
45 0.26
46 0.27
47 0.27
48 0.27
49 0.32
50 0.37
51 0.43
52 0.42
53 0.44
54 0.46
55 0.47
56 0.46
57 0.41
58 0.35
59 0.28
60 0.29
61 0.29
62 0.27
63 0.25
64 0.26
65 0.27
66 0.31
67 0.35
68 0.35
69 0.33
70 0.37
71 0.43
72 0.42
73 0.39
74 0.36
75 0.32
76 0.28
77 0.26
78 0.22
79 0.15
80 0.14
81 0.13
82 0.1
83 0.08
84 0.06
85 0.06
86 0.05
87 0.11
88 0.13
89 0.14
90 0.18
91 0.24
92 0.27
93 0.33
94 0.41
95 0.43
96 0.46
97 0.53
98 0.51
99 0.46
100 0.45
101 0.39
102 0.33
103 0.28
104 0.26
105 0.18
106 0.18
107 0.17
108 0.18
109 0.18
110 0.22
111 0.24
112 0.21
113 0.21
114 0.22
115 0.23
116 0.2
117 0.24
118 0.19
119 0.2
120 0.2
121 0.21
122 0.25
123 0.31
124 0.33
125 0.3
126 0.29
127 0.26
128 0.26
129 0.31
130 0.29
131 0.25
132 0.29
133 0.29
134 0.29
135 0.27
136 0.27
137 0.22
138 0.18
139 0.16
140 0.15
141 0.2
142 0.2
143 0.2