Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VL17

Protein Details
Accession K5VL17    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
436-456RFGVPGIRKYLRRRSRKAKVRBasic
NLS Segment(s)
PositionSequence
443-456RKYLRRRSRKAKVR
Subcellular Location(s) plas 19, E.R. 5, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004277  PSS  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0106245  F:L-serine-phosphatidylethanolamine phosphatidyltransferase activity  
GO:0006659  P:phosphatidylserine biosynthetic process  
KEGG pco:PHACADRAFT_212696  -  
Pfam View protein in Pfam  
PF03034  PSS  
Amino Acid Sequences MSTPLPEHPAGEAESHVLLLAEESDAALSPTAEGPEPTPGLDGTPVRWYDANRTESYTRIVPFQEVHDTSVEFFYKPITLSVLGVAMAILAYVATTQDVLEEGRDKRSVGAWAAIAGFLLFGIIQFRDGPFVRPHPVFWRLVLGVNLLYELALVFLLFQDLNSARAMMKYLDPNLGKPLPEKSYAENCDFTPQNVWNAVDIFCLAHAIGWFGKALILRDYWFCWILSIAFELAEYSLQHQLANFAECWWDHWVLDVLICNWLGTYLGMKTCQYFEVKKYQWRGFRQIRGVRGKTRRVISQFSPADWTTFKWEGTADFTHYVAVVLLLAGFLAAELNPFYLKTLLWMEPEHPFVTARLAGIFLCALPAVREYYQYVGDPRRAVRMGQHIWLLLATICTELLAITKWSKGQFPVPLPQRVKVAWAVGGALLVLYPTVRFGVPGIRKYLRRRSRKAKVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.13
4 0.1
5 0.08
6 0.08
7 0.07
8 0.06
9 0.05
10 0.05
11 0.06
12 0.06
13 0.06
14 0.06
15 0.06
16 0.06
17 0.08
18 0.09
19 0.1
20 0.1
21 0.11
22 0.16
23 0.17
24 0.16
25 0.16
26 0.14
27 0.15
28 0.19
29 0.18
30 0.15
31 0.21
32 0.21
33 0.23
34 0.25
35 0.26
36 0.31
37 0.38
38 0.41
39 0.36
40 0.42
41 0.41
42 0.41
43 0.43
44 0.38
45 0.31
46 0.29
47 0.28
48 0.25
49 0.25
50 0.27
51 0.31
52 0.27
53 0.28
54 0.26
55 0.26
56 0.25
57 0.26
58 0.24
59 0.15
60 0.14
61 0.14
62 0.14
63 0.14
64 0.13
65 0.12
66 0.12
67 0.13
68 0.13
69 0.12
70 0.11
71 0.1
72 0.09
73 0.06
74 0.05
75 0.04
76 0.03
77 0.02
78 0.02
79 0.02
80 0.03
81 0.03
82 0.03
83 0.03
84 0.04
85 0.05
86 0.05
87 0.07
88 0.12
89 0.13
90 0.16
91 0.18
92 0.18
93 0.18
94 0.2
95 0.22
96 0.18
97 0.19
98 0.16
99 0.16
100 0.16
101 0.14
102 0.12
103 0.09
104 0.07
105 0.04
106 0.04
107 0.03
108 0.02
109 0.04
110 0.04
111 0.05
112 0.06
113 0.06
114 0.1
115 0.11
116 0.15
117 0.17
118 0.21
119 0.25
120 0.26
121 0.28
122 0.29
123 0.33
124 0.31
125 0.28
126 0.29
127 0.25
128 0.26
129 0.24
130 0.19
131 0.15
132 0.13
133 0.13
134 0.08
135 0.07
136 0.05
137 0.04
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.04
144 0.04
145 0.03
146 0.06
147 0.07
148 0.08
149 0.08
150 0.09
151 0.08
152 0.09
153 0.1
154 0.08
155 0.11
156 0.12
157 0.14
158 0.19
159 0.19
160 0.2
161 0.24
162 0.24
163 0.22
164 0.21
165 0.24
166 0.21
167 0.23
168 0.24
169 0.23
170 0.3
171 0.33
172 0.34
173 0.31
174 0.29
175 0.31
176 0.29
177 0.25
178 0.21
179 0.18
180 0.18
181 0.18
182 0.18
183 0.14
184 0.15
185 0.14
186 0.11
187 0.1
188 0.08
189 0.06
190 0.06
191 0.05
192 0.04
193 0.04
194 0.05
195 0.05
196 0.05
197 0.05
198 0.05
199 0.06
200 0.06
201 0.07
202 0.07
203 0.08
204 0.08
205 0.09
206 0.1
207 0.11
208 0.11
209 0.1
210 0.09
211 0.08
212 0.08
213 0.08
214 0.07
215 0.06
216 0.05
217 0.05
218 0.05
219 0.04
220 0.05
221 0.04
222 0.05
223 0.08
224 0.08
225 0.08
226 0.08
227 0.1
228 0.1
229 0.11
230 0.09
231 0.08
232 0.08
233 0.08
234 0.11
235 0.12
236 0.12
237 0.1
238 0.11
239 0.12
240 0.11
241 0.12
242 0.1
243 0.08
244 0.08
245 0.08
246 0.07
247 0.06
248 0.06
249 0.05
250 0.05
251 0.05
252 0.05
253 0.06
254 0.07
255 0.08
256 0.09
257 0.09
258 0.11
259 0.13
260 0.14
261 0.16
262 0.25
263 0.28
264 0.33
265 0.39
266 0.44
267 0.49
268 0.52
269 0.59
270 0.57
271 0.61
272 0.64
273 0.62
274 0.65
275 0.66
276 0.65
277 0.64
278 0.64
279 0.64
280 0.61
281 0.59
282 0.57
283 0.52
284 0.53
285 0.46
286 0.49
287 0.43
288 0.38
289 0.39
290 0.33
291 0.31
292 0.26
293 0.25
294 0.21
295 0.22
296 0.21
297 0.17
298 0.17
299 0.16
300 0.2
301 0.2
302 0.17
303 0.16
304 0.16
305 0.16
306 0.15
307 0.14
308 0.1
309 0.08
310 0.05
311 0.04
312 0.03
313 0.03
314 0.03
315 0.02
316 0.02
317 0.02
318 0.02
319 0.02
320 0.03
321 0.03
322 0.04
323 0.04
324 0.05
325 0.06
326 0.06
327 0.06
328 0.09
329 0.13
330 0.14
331 0.16
332 0.17
333 0.18
334 0.2
335 0.23
336 0.21
337 0.17
338 0.16
339 0.15
340 0.17
341 0.16
342 0.13
343 0.11
344 0.11
345 0.1
346 0.11
347 0.1
348 0.07
349 0.06
350 0.06
351 0.05
352 0.05
353 0.07
354 0.1
355 0.1
356 0.12
357 0.13
358 0.16
359 0.17
360 0.18
361 0.23
362 0.24
363 0.27
364 0.29
365 0.29
366 0.33
367 0.33
368 0.32
369 0.33
370 0.38
371 0.37
372 0.37
373 0.37
374 0.31
375 0.3
376 0.29
377 0.23
378 0.14
379 0.11
380 0.08
381 0.07
382 0.07
383 0.06
384 0.06
385 0.05
386 0.06
387 0.07
388 0.09
389 0.1
390 0.12
391 0.16
392 0.18
393 0.21
394 0.23
395 0.28
396 0.33
397 0.36
398 0.44
399 0.48
400 0.56
401 0.56
402 0.56
403 0.54
404 0.47
405 0.46
406 0.39
407 0.35
408 0.27
409 0.24
410 0.22
411 0.18
412 0.17
413 0.13
414 0.1
415 0.07
416 0.05
417 0.04
418 0.04
419 0.04
420 0.05
421 0.06
422 0.06
423 0.07
424 0.08
425 0.18
426 0.25
427 0.29
428 0.36
429 0.41
430 0.49
431 0.58
432 0.68
433 0.68
434 0.72
435 0.78
436 0.82