Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2R6Z4

Protein Details
Accession G2R6Z4    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
219-238TPPMRSRSLAKKPKERPPVQHydrophilic
NLS Segment(s)
PositionSequence
223-234RSRSLAKKPKER
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013734  TF_Nrm1/Whi5  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
KEGG ttt:THITE_2116672  -  
Pfam View protein in Pfam  
PF08528  Whi5  
Amino Acid Sequences MSSPFKPQPEAVADRVLRRAEIRKMARRLQNRLALAQFKTKHNLVNETLDTIEPKFEHEMRRRRLQDRDILSDSSSSASDLPYSARALMSSPLKAPLFSDAIGSSNGSTGHRKRTYMASFDDTFSSPSKRFRQSPTAHRSFSGHHYQQQHQFTQSSPIKPRRQQHFTTSTGPDLSFYSGSRQISDVLTPTNYAANSDDEDDLPTHSFHTSHIRVSPPRTPPMRSRSLAKKPKERPPVQETKSGEEGADLLLYLAASPSPANPPKIRMDPPSTPPPKNNKLALPSSMMTTPGGGNPYPATPGLGFDFAEFLHMTPSPAQKPWKTPATHTGGKTPRSAARRRLTFDDTPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.42
4 0.35
5 0.35
6 0.39
7 0.38
8 0.45
9 0.51
10 0.56
11 0.63
12 0.7
13 0.75
14 0.76
15 0.77
16 0.76
17 0.75
18 0.68
19 0.65
20 0.62
21 0.58
22 0.52
23 0.52
24 0.48
25 0.44
26 0.47
27 0.44
28 0.44
29 0.42
30 0.46
31 0.41
32 0.43
33 0.4
34 0.36
35 0.35
36 0.3
37 0.28
38 0.22
39 0.21
40 0.14
41 0.16
42 0.19
43 0.21
44 0.3
45 0.38
46 0.48
47 0.52
48 0.62
49 0.67
50 0.68
51 0.73
52 0.71
53 0.7
54 0.67
55 0.67
56 0.61
57 0.55
58 0.5
59 0.41
60 0.35
61 0.27
62 0.2
63 0.13
64 0.1
65 0.09
66 0.09
67 0.08
68 0.09
69 0.1
70 0.11
71 0.11
72 0.1
73 0.1
74 0.11
75 0.15
76 0.16
77 0.15
78 0.15
79 0.19
80 0.2
81 0.19
82 0.19
83 0.18
84 0.17
85 0.16
86 0.16
87 0.12
88 0.13
89 0.13
90 0.13
91 0.1
92 0.09
93 0.1
94 0.1
95 0.16
96 0.18
97 0.27
98 0.29
99 0.3
100 0.31
101 0.39
102 0.41
103 0.39
104 0.4
105 0.36
106 0.35
107 0.35
108 0.34
109 0.26
110 0.24
111 0.22
112 0.21
113 0.17
114 0.23
115 0.28
116 0.33
117 0.36
118 0.41
119 0.49
120 0.53
121 0.62
122 0.65
123 0.64
124 0.59
125 0.56
126 0.52
127 0.44
128 0.43
129 0.41
130 0.34
131 0.33
132 0.37
133 0.41
134 0.47
135 0.48
136 0.43
137 0.36
138 0.35
139 0.3
140 0.34
141 0.34
142 0.31
143 0.35
144 0.43
145 0.48
146 0.53
147 0.61
148 0.61
149 0.63
150 0.61
151 0.62
152 0.59
153 0.56
154 0.55
155 0.48
156 0.4
157 0.34
158 0.31
159 0.24
160 0.18
161 0.15
162 0.1
163 0.09
164 0.11
165 0.14
166 0.14
167 0.14
168 0.14
169 0.14
170 0.14
171 0.14
172 0.11
173 0.09
174 0.09
175 0.09
176 0.08
177 0.09
178 0.08
179 0.08
180 0.09
181 0.09
182 0.1
183 0.11
184 0.11
185 0.1
186 0.11
187 0.1
188 0.1
189 0.1
190 0.09
191 0.08
192 0.08
193 0.08
194 0.09
195 0.17
196 0.17
197 0.18
198 0.21
199 0.25
200 0.27
201 0.32
202 0.37
203 0.34
204 0.4
205 0.41
206 0.42
207 0.45
208 0.49
209 0.53
210 0.47
211 0.5
212 0.52
213 0.6
214 0.65
215 0.65
216 0.68
217 0.69
218 0.77
219 0.81
220 0.76
221 0.74
222 0.74
223 0.77
224 0.7
225 0.69
226 0.62
227 0.56
228 0.54
229 0.46
230 0.37
231 0.26
232 0.24
233 0.16
234 0.13
235 0.08
236 0.05
237 0.04
238 0.04
239 0.04
240 0.04
241 0.03
242 0.04
243 0.04
244 0.05
245 0.12
246 0.16
247 0.21
248 0.22
249 0.27
250 0.32
251 0.38
252 0.41
253 0.41
254 0.45
255 0.46
256 0.51
257 0.58
258 0.58
259 0.55
260 0.59
261 0.63
262 0.63
263 0.64
264 0.62
265 0.57
266 0.57
267 0.58
268 0.53
269 0.48
270 0.4
271 0.36
272 0.32
273 0.27
274 0.21
275 0.18
276 0.16
277 0.13
278 0.15
279 0.13
280 0.14
281 0.14
282 0.14
283 0.15
284 0.15
285 0.15
286 0.12
287 0.15
288 0.16
289 0.16
290 0.15
291 0.13
292 0.14
293 0.11
294 0.13
295 0.11
296 0.09
297 0.1
298 0.1
299 0.12
300 0.16
301 0.22
302 0.23
303 0.28
304 0.36
305 0.39
306 0.45
307 0.51
308 0.56
309 0.52
310 0.54
311 0.59
312 0.6
313 0.62
314 0.57
315 0.59
316 0.58
317 0.58
318 0.56
319 0.52
320 0.51
321 0.52
322 0.58
323 0.58
324 0.61
325 0.66
326 0.68
327 0.7
328 0.7