Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2QYU1

Protein Details
Accession G2QYU1    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
345-395AETPAKEEPPKKKAKKALPESNDDRLDKEIAERKAKLKKQKAAAKKKVADIHydrophilic
NLS Segment(s)
PositionSequence
192-205GKRVPAPKGKKTKR
322-392AKVAEKPNIGKKRKPLPAEPEEPAETPAKEEPPKKKAKKALPESNDDRLDKEIAERKAKLKKQKAAAKKKV
Subcellular Location(s) nucl 15.5, cyto_nucl 14, cyto 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023674  Ribosomal_L1-like  
IPR028364  Ribosomal_L1/biogenesis  
IPR016095  Ribosomal_L1_3-a/b-sand  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
KEGG ttt:THITE_2114270  -  
Pfam View protein in Pfam  
PF00687  Ribosomal_L1  
CDD cd00403  Ribosomal_L1  
Amino Acid Sequences MSKSAVVAKGADSLVPVDPDQTLKACKALVAHIKKSAAAPRNDGKQNLLADEESTVAETPVWLTLTTKKHIHDSHRLQPGKIVLPHSLNDKEELSVCLITADPQRWYKNAVADGFPEDLRAKIGRVIDISHIRAKFKAFEAQRKLFSEHDVFLADDRIINRLPKALGKTFYKTTTKRPIPVVLMAQRDKVDGKRVPAPKGKKTKRDPAENVNARPIPEIVNEVQRAIGAALVHLSPSSNTAVKVGYASWEPEKLAANIDTVVREMVERFVPQKWQNVRNIYIKGPQTAALPIYQTDELWLDDSKVVPDGQEPPSALPGKHQAKVAEKPNIGKKRKPLPAEPEEPAETPAKEEPPKKKAKKALPESNDDRLDKEIAERKAKLKKQKAAAKKKVADI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.16
4 0.13
5 0.13
6 0.15
7 0.16
8 0.17
9 0.19
10 0.18
11 0.2
12 0.19
13 0.19
14 0.19
15 0.25
16 0.32
17 0.37
18 0.4
19 0.44
20 0.44
21 0.44
22 0.47
23 0.48
24 0.46
25 0.42
26 0.45
27 0.46
28 0.54
29 0.58
30 0.54
31 0.49
32 0.47
33 0.45
34 0.39
35 0.35
36 0.26
37 0.22
38 0.21
39 0.18
40 0.13
41 0.12
42 0.11
43 0.08
44 0.08
45 0.07
46 0.07
47 0.08
48 0.09
49 0.08
50 0.1
51 0.17
52 0.22
53 0.27
54 0.3
55 0.3
56 0.38
57 0.43
58 0.49
59 0.53
60 0.56
61 0.6
62 0.66
63 0.67
64 0.58
65 0.56
66 0.54
67 0.49
68 0.45
69 0.38
70 0.32
71 0.33
72 0.34
73 0.36
74 0.34
75 0.28
76 0.27
77 0.25
78 0.22
79 0.21
80 0.21
81 0.17
82 0.14
83 0.13
84 0.11
85 0.1
86 0.12
87 0.15
88 0.15
89 0.17
90 0.21
91 0.24
92 0.24
93 0.28
94 0.28
95 0.3
96 0.32
97 0.31
98 0.27
99 0.27
100 0.28
101 0.26
102 0.23
103 0.2
104 0.15
105 0.13
106 0.14
107 0.13
108 0.11
109 0.13
110 0.14
111 0.14
112 0.14
113 0.16
114 0.18
115 0.22
116 0.24
117 0.26
118 0.26
119 0.26
120 0.26
121 0.26
122 0.24
123 0.22
124 0.27
125 0.26
126 0.35
127 0.42
128 0.45
129 0.48
130 0.48
131 0.48
132 0.41
133 0.41
134 0.34
135 0.26
136 0.23
137 0.2
138 0.17
139 0.15
140 0.15
141 0.11
142 0.1
143 0.09
144 0.1
145 0.1
146 0.11
147 0.11
148 0.12
149 0.13
150 0.14
151 0.18
152 0.2
153 0.23
154 0.25
155 0.29
156 0.29
157 0.33
158 0.37
159 0.35
160 0.4
161 0.46
162 0.47
163 0.47
164 0.47
165 0.46
166 0.41
167 0.42
168 0.38
169 0.33
170 0.34
171 0.31
172 0.3
173 0.26
174 0.25
175 0.23
176 0.19
177 0.22
178 0.19
179 0.21
180 0.27
181 0.31
182 0.35
183 0.41
184 0.46
185 0.47
186 0.56
187 0.61
188 0.63
189 0.66
190 0.71
191 0.71
192 0.75
193 0.71
194 0.68
195 0.72
196 0.68
197 0.62
198 0.57
199 0.51
200 0.41
201 0.37
202 0.3
203 0.2
204 0.15
205 0.16
206 0.12
207 0.16
208 0.16
209 0.15
210 0.15
211 0.13
212 0.13
213 0.1
214 0.1
215 0.05
216 0.05
217 0.05
218 0.05
219 0.05
220 0.05
221 0.05
222 0.04
223 0.06
224 0.08
225 0.08
226 0.08
227 0.09
228 0.1
229 0.1
230 0.1
231 0.08
232 0.08
233 0.08
234 0.1
235 0.1
236 0.11
237 0.11
238 0.12
239 0.14
240 0.12
241 0.14
242 0.13
243 0.12
244 0.12
245 0.12
246 0.11
247 0.1
248 0.09
249 0.07
250 0.07
251 0.07
252 0.07
253 0.08
254 0.09
255 0.11
256 0.12
257 0.19
258 0.21
259 0.29
260 0.35
261 0.4
262 0.46
263 0.49
264 0.53
265 0.53
266 0.53
267 0.47
268 0.46
269 0.42
270 0.37
271 0.32
272 0.28
273 0.23
274 0.22
275 0.2
276 0.14
277 0.13
278 0.12
279 0.14
280 0.13
281 0.12
282 0.11
283 0.12
284 0.11
285 0.12
286 0.12
287 0.1
288 0.11
289 0.11
290 0.11
291 0.11
292 0.11
293 0.09
294 0.11
295 0.15
296 0.17
297 0.19
298 0.19
299 0.19
300 0.25
301 0.27
302 0.25
303 0.23
304 0.31
305 0.33
306 0.36
307 0.38
308 0.36
309 0.41
310 0.49
311 0.53
312 0.52
313 0.49
314 0.53
315 0.6
316 0.66
317 0.65
318 0.63
319 0.64
320 0.66
321 0.72
322 0.72
323 0.7
324 0.7
325 0.73
326 0.74
327 0.67
328 0.62
329 0.57
330 0.51
331 0.45
332 0.38
333 0.29
334 0.26
335 0.27
336 0.28
337 0.31
338 0.39
339 0.45
340 0.52
341 0.63
342 0.67
343 0.73
344 0.76
345 0.8
346 0.83
347 0.85
348 0.86
349 0.81
350 0.84
351 0.81
352 0.79
353 0.75
354 0.65
355 0.56
356 0.48
357 0.43
358 0.34
359 0.36
360 0.35
361 0.36
362 0.42
363 0.44
364 0.49
365 0.57
366 0.65
367 0.68
368 0.7
369 0.72
370 0.75
371 0.81
372 0.85
373 0.86
374 0.89
375 0.89